Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

SAFENGINEERINGLINCSSYSTEMPVTLT3424 6809e95570178180e3d69e6d Products https://www.safelincsindia.in
Gas Suppression
Gas Suppression
In Stock
COD not available
Server Room Protection

Gas Suppression

In Stock
COD not available

Description

Product details

FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections. FM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment. FM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation. FM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression. Halon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace

Have any question or need any business consultation?

Have any question or need any business consultation?

Contact Us
Chat with us