Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

SAFENGINEERINGLINCSSYSTEMPVTLT3424 6809e95570178180e3d69e6d Products https://www.safelincsindia.in
AMC
AMC
In Stock
COD not available
Services & Maintenances

AMC

In Stock
COD not available

Description

Product details

Well-maintained fire systems help save lives and property As the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most. Through our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment. we are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases. SAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians. Inspection and Testing Today, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems. Fire Alarm and Detection System Fire Suppression Systems Hydrant System Fire Pump Room Equipment Fire Extinguishers Sprinkler Systems Emergency/Exit Lights Access Systems Surveillance Systems Public Address Systems VESDA System Repair Whether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses. Strategically located field technicians for emergency response. Our Technicians have instant access to past inspection and maintenance history. System Recharge When your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system. System Monitoring SAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS. Training SAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required. Training Topics may include: Overview of system components. Understanding of system application. Sequence of operations. Explanation and differentiation of warning or alarm indicators. Resetting and/or aborting functions. Routine trouble shooting techniques. How to call for service. System maintenance requirements. Safety considerations and issues. Recommendations for system improvement, if necessary Modification When your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements

Have any question or need any business consultation?

Have any question or need any business consultation?

Contact Us
Chat with us