Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

SAFENGINEERINGLINCSSYSTEMPVTLT3424 6809e95570178180e3d69e6d Products https://www.safelincsindia.in
{ "products": [ { "_id": "681b5f5b4162939e1cd4d098", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Emergency/Exit Signages", "description": "Safety is the number one reason to clearly have Exit emergency signs marked on doors, stairways, halls and elevators, for where exits are not immediately visible to the occupant. Exit emergency signs mark the way to safety, featuring internationally recognised symbols. They are an effective guidance tool, suitable for high traffic areas and to convey important messages, helping to reduce panic and confusion by providing a clear, easy-to-follow directional system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "reduce panic", "immediately visible", "emergencyexit signagessafety", "high traffic areas", "doors stairways halls" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 15, "imageuri": "https://bizimages.withfloats.com/actual/3766731d11634958944bd9946d6e1572.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/3766731d11634958944bd9946d6e1572.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:25:47.862Z", "updatedon": "2025-05-07T13:25:47.863Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN//emergency-exit-signages/15", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Evacuation System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d9d6925cdc24b7681c5", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Foam water sprinkler", "description": "Designing a foam fire suppression system requires special expertise\n\nLow Expansion Foam\n\nLow Expansion foam offers a 5:1 expansion rate, making it the foam system of choice to protect large and hazardous facilities, including; petro-chemical tank farms, loading docks, processing areas and refineries and liquefied natural gas storage.\n\nHigh Expansion Foam\n\nWith an expansion rate of 500:1, High Expansion foam systems are more suitable to protect less common three-dimensional hazardous facilities including; warehouses, conveyors, aircraft hangars and tunnels. As such, High Expansion foam is measured by volume output rather than application rate, as is typical of low expansion foams.\n\nDischarge Devices\n\nWith both low and high expansion foam systems, once a facility has been evaluated either an ‘Aspirating’ or ‘Non-Aspirating’ discharge device’ will be recommended, based on the facilities requirements.\n\nAspirating discharge devices – produces a more viscous foam – great for reducing burn back and keeping the foam contained.\nNon-aspirating discharge devices – are best used where the foam is needed to spread over a large area. Talk to a Wormald specialist about your situation.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "wormald specialist", "recommended based", "application rate", "volume output", "hazardous facilities", "protect large", "foam system", "expansion rate", "high expansion foam", "viscous foam great", "foam water sprinklerdesigning", "large area talk", "reducing burn back", "nonaspirating discharge device" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 8, "imageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:18:21.329Z", "updatedon": "2025-05-07T13:18:21.329Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/foam-water-sprinkler/8", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d2a701ce9d7e115dce8", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Water Spray systems", "description": "Water spray nozzles are designed to spray water directly onto the hazard surface via a series of nozzles with a carefully predetermined spray pattern. They are suitable for a variety of special hazards including transformer, turbines and combustible liquid hazards and systems can be individually tailored to your needs.\n\nHigh velocity systems – getting under the fire\n\nHigh velocity systems are often used to protect equipment that incorporate heavy or medium oils; equipment such as transformers, circuit breakers, diesel engines and fuel oil storage tanks, turbo alternator lube oil systems and oil fired boilers.\n\nThe high velocity nozzles are specifically designed to discharge a jet of water at high speed. The water jet forms a cone of coarse spray of uniform density which is discharged over a defined area. The coarse spray is able to penetrate the flame zone and reach the surface of the burning oil. The turbulence created by the high velocity spray forms an oil-in-water emulsion on the surface of the oil that will not burn. This “emulsification” is the principal way the fire is extinguished, along with a cooling and smothering effect.\n\nThe shape of the spray cone, the fire area contacted and the water flow is all controlled by the nozzle specifications – the orifice size and the shape of the internal swirl plate – along with the water pressure and the orientation of the nozzle.\n\nMedium velocity systems – cooling fire down\n\nMedium velocity sprayers discharge a water spray of finely divided droplets at medium velocity. They are ideal for protecting hazards involving light oils where emulsification from high velocity sprayers is not possible. The fine spray has a high heat absorption rate so medium velocity sprayers are an effective method of protecting adjacent plant and structures from heat during a fire by providing a continuous cooling spray over the exposed surfaces. Keeping nearby equipment cool minimises damage and reduces the risk of explosion.\n\nMedium velocity sprayers can be used in combination with other fire fighting systems – dry chemical and foam can be used effectively under the discharge. The fine spray also works to dilute and disperse flammable vapours. The sprayers use an external deflector to achieve the desired discharge angle and spray characteristics", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "hazard surface", "specifically designed", "spray cone", "external deflector", "effective method", "orifice size", "nozzle specifications", "smothering effect", "oilinwater emulsion", "turbulence created", "burning oil", "flame zone", "uniform density", "incorporate heavy", "individually tailored", "transformer turbines", "water pressure", "water flow", "spray characteristics", "fine spray", "coarse spray", "water spray", "defined area", "protect equipment", "special hazards", "high speed", "medium velocity", "water jet forms", "fire area contacted", "continuous cooling spray", "spray water directly", "high velocity nozzles", "high velocity systems", "desired discharge angle", "medium velocity sprayers", "high velocity sprayers", "oil fired boilers", "medium oils equipment", "combustible liquid hazards", "disperse flammable vapours", "protecting adjacent plant", "finely divided droplets", "internal swirl plate" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 7, "imageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:16:26.609Z", "updatedon": "2025-05-07T13:16:26.609Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/water-spray-systems/7", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6329f619d1f5f02ff84f", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "AMC ", "description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": null, "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 24, "imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:42:01.786Z", "updatedon": "2025-05-07T13:42:01.787Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/amc-/24", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Services & Maintenances", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6220e66948a919653f2f", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire extinguisher", "description": "A Fire extinguisher is a device which can be used to control a fire. Fire extinguishers can help remove the fire, and may stop it from burning. Depending on the size, some fire extinguishers can be carried around and operated by hand. There are different kinds of fire extinguishers. Different kinds of fire can be controlled by different substances Classfication of Fire Extinguishers\n\nClass A fires involve organic solids such as paper and wood.\nClass B fires involve flammable or combustible liquids, including petrol, grease, and oil.\nClass C fires involve flammable gases.\nClass D fires involve combustible metals.\nClass E fires involve electrical equipment/appliances.\nClass F fires involve cooking fat and oil.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "oil class", "petrol grease", "combustible liquids", "substances classfication", "burning depending", "wood class", "fire extinguishers", "fire fire extinguishers", "fire extinguishers class", "fires involve flammable" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 23, "imageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:37:36.166Z", "updatedon": "2025-05-07T13:37:36.166Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/fire-extinguisher/23", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire extinguisher", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b61def36ed9034d8fc8e1", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Water Leak Detection", "description": "Water leaks can cause great damage to your property especially when it comes to electronics. A water detection sensor detects the presence of water before it contacts electronics or other valuables in the room. Use a leak detection sensor having a water sensor alarm to protect your property. When the leak detection equipment senses a leakage, the property manager is notified immediately so that action to remedy the cause can be taken as soon as possible.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "property manager", "contacts electronics", "notified immediately", "great damage", "water sensor alarm", "leak detection sensor" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 22, "imageuri": "https://bizimages.withfloats.com/actual/64ab299783ef4ba59557095991ef881d.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/64ab299783ef4ba59557095991ef881d.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:36:30.703Z", "updatedon": "2025-05-07T13:36:30.703Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/water-leak-detection/22", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6163bd1f50f146548db6", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Gas Suppression", "description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "90 percent", "625 percent", "discharge nozzle", "hazard area", "agent reaches", "effective means", "modular hardware", "fm200novec 1230 system", "propelling mechanism", "concentration range", "data processing", "computer servers", "requires minimal space" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 21, "imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:34:27.743Z", "updatedon": "2025-05-07T13:34:27.744Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/gas-suppression/21", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60b44d3fb9d238d49dde", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Server Room Protection", "description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "small fire", "critical facilities", "sensitive electronics", "catastrophic loss", "early stages", "detect alert", "obligatory part", "server room", "damaging highvalue equipment", "server room design", "interrupting vital operations", "computercontrolled manufacturing operations" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 20, "imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:31:32.102Z", "updatedon": "2025-05-07T13:31:32.102Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/server-room-protection/20", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60731670c79d70e49a22", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Intrusion Systems", "description": "Intruder detection systems are an integral element in your security management system. Security performance enhancements and cost savings can be achieved by combining intrusion alarm systems together with video surveillance and access control. Siemens embraces this shift in mindset and its intruder detection systems that can be integrated and even monitored by one central management station (Surveillance Fusion).\n\nThe Other various elements involved in this are\n\nPIR – Pet Immune passive infrared sensor\nMotion Sensor 360deg\nGlass break sensor", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "elements involved", "video surveillance", "cost savings", "integral element", "intruder detection systems" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 19, "imageuri": "https://bizimages.withfloats.com/actual/24e36ff5d81448d9a976ed96f39ca792.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/24e36ff5d81448d9a976ed96f39ca792.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:30:27.635Z", "updatedon": "2025-05-07T13:30:27.636Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/intrusion-systems/19", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Security Systems", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }

Still searching for
model options suitable?

Still searching for
model options suitable?

Chat with us