Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360
android app
/
iOS App/ web portal.
{
"products": [
{
"_id": "681b5de53a26099a76a38090",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Fire Detection and Alarm",
"description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": null,
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 9,
"imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:19:33.065Z",
"updatedon": "2025-05-07T13:19:33.066Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/fire-detection-and-alarm/9",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6329f619d1f5f02ff84f",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "AMC ",
"description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": null,
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 24,
"imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:42:01.786Z",
"updatedon": "2025-05-07T13:42:01.787Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/amc-/24",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Services & Maintenances",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5cf1bc744980d54e15b4",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Deluge System",
"description": "A deluge system is similar to a pre-action system except the sprinkler heads are open and the pipe is not pressurized with air. Deluge systems are connected to a water supply through a deluge valve that is opened by the operation of a smoke or heat detection system. The detection system is installed in the same area as the sprinklers. When the detection system is activated water discharges through all of the sprinkler heads in the system. Deluge systems are used in places that are considered high hazard areas such as power plants, aircraft hangars and chemical storage or processing facilities. Deluge systems are needed where high velocity suppression is necessary to prevent fire spread.\n\nDeluge Fire Sprinkler Systems differ from conventional Fire Sprinkler Systems in the sense that all sprinkles or nozzles employed in the system are open and when water is released into the system it flows from all discharge devices. As such, this special type of system is generally found within industrial type hazards that require the application of water over a large hazard or area. The control of water is accomplished by the use of a Deluge Valve which is a device that prevents water from entering the system piping until required. A detection system which may incorporate the use of heat, smoke, or flame detectors is used to open the Deluge Valve when a fire or its products of combustion are detected. All system piping is filled with water which discharges from the open sprinklers and nozzles used in the system. In addition to the application of water some deluge systems will incorporate the use of a foam concentrate to mix with water and form a foam solution which can then provide a protective blanket of foam to help control the development of a fire.\nDeluge Fire Sprinkler systems protect extra hazard occupancies that require significant amounts of water to cool and control the growth or development of a fire. Typically they are employed on hazards that contain low flash point flammable liquids or hazards with large amounts of combustible liquids. These types of hazards may include, oil extraction processes, transformers, tank or vessel protection, distillation processes. Water or Foam Deluge systems are used in the protection of large Aircraft Hangers as one primary means of fire protection.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"open sprinklers",
"nozzles employed",
"fire protection",
"prevents water",
"water supply",
"fire typically",
"system piping",
"preaction system",
"primary means",
"combustible liquids",
"protective blanket",
"foam solution",
"foam concentrate",
"flame detectors",
"heat smoke",
"generally found",
"discharge devices",
"chemical storage",
"sprinkler heads",
"detection system",
"large hazard",
"deluge valve",
"special type",
"large amounts",
"deluge systems",
"activated water discharges",
"heat detection system",
"industrial type hazards",
"system deluge systems",
"foam deluge systems",
"require significant amounts",
"air deluge systems",
"large aircraft hangers",
"high velocity suppression"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 6,
"imageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:15:29.727Z",
"updatedon": "2025-05-07T13:15:29.728Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/deluge-system/6",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Sprinkler System",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6163bd1f50f146548db6",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Gas Suppression",
"description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"90 percent",
"625 percent",
"discharge nozzle",
"hazard area",
"agent reaches",
"effective means",
"modular hardware",
"fm200novec 1230 system",
"propelling mechanism",
"concentration range",
"data processing",
"computer servers",
"requires minimal space"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 21,
"imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:34:27.743Z",
"updatedon": "2025-05-07T13:34:27.744Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/gas-suppression/21",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Server Room Protection",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6014162e7d0c09518569",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Access Control Systems",
"description": "Access control systems deliver maximum protection, versatility, simple operation and cost efficiency – all while helping to limit; corporate liability, employee theft, workplace violence, and the high cost of re-keying. Growing companies throughout the region are benefiting from the scalable nature of access control solutions.\n\nThe access control system is the central component of any integrated security system for several reasons. The access control software is installed on a server which already has the employee database and which is already connected to the LAN/WAN for communications. The next step is to integrate the intrusion detection system and the digital video system into the access control software and have the systems operate as one logical system.\n\nReader\nMagnetic\nProximity\nIntelligent\nBio-metric\nFace Recognition\nIris Scanner\nTime & attendance\nVisitor Management\nGuard Tour",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"systems operate",
"employee database",
"central component",
"scalable nature",
"high cost",
"cost efficiency",
"digital video system",
"intrusion detection system",
"access control software",
"integrated security system",
"access control system",
"access control solutions",
"rekeying growing companies"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 18,
"imageuri": "https://bizimages.withfloats.com/actual/58e76ad807dd49ccb94194e0d5eca8a2.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/58e76ad807dd49ccb94194e0d5eca8a2.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:28:52.954Z",
"updatedon": "2025-05-07T13:28:52.955Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/access-control-systems/18",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5fadab7a210d40661fb1",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Surveillance System",
"description": "Video surveillance delivers unprecedented abilities to monitor and manage the risks of today’s business environments. These easy to use systems are successfully working to help reduce theft, workplace violence, and fraudulent workman’s compensation claims.\n\nAnalog System : Cameras on an analog CCTV system send their video in the traditional base band format over coax cabling back to a digital video recorder (DVR). Here, video is digitized and stored on hard drives. Most modern DVRs are a network device, and as such can be accessed remotely from the LAN, or with the proper configuration, from across a WAN or the internet. Video is kept on hard drives, typically on a FIFO basis so there is always a rolling video archive of the past X days. So, despite the fact that video is being transmitted from the cameras in an analog format, live and recorded video is still available over the network.\nIP Video System : IP video cameras broadcast their video as a digital stream over an IP network. Like an analog system, video is recorded on hard drives, but since the video is an IP stream straight from the camera, there is more flexibility as to how and where that video is recorded. The DVR is replaced with an NVR (network video recorder), which in some cases is just software since it doesn’t need to convert analog to digital. Video footage can then be stored on new or existing network RAID drives as directed by the NVR software.\n\nAnd the biggest factors driving interest in IP video systems is the high resolution that they can offer. Analog cameras max out on resolution at about 680 TVL which equates to roughly 0.6 mega pixels. High end IP cameras on the other hand, are currently available at resolutions above 5 mega pixels. This high resolution in turn gives users the ability to zoom in on video after the fact, and still have usable video.\n\nAnother benefit to IP video is that it is much more compatible with wireless. Wireless analog systems are available, but they either have to convert to IP anyway and broadcast over the 802.11 IP network (which adds cost for encoders), or they get crammed onto the over saturated regulated frequencies and often encounter interference.\n\nWireless security camera systems: it take away the worry of video cables running around your property all you need is a power source. Using the latest digital technology, some wireless CCTV cameras offer an improved transmission range of up to 200m. Although these cameras are often easier to install and move around than wired ones.\nVideo Analytics (Management): Video Analytics, also referred to as Video Content Analysis (VCA), is a generic term used to describe computerized processing and analysis of video streams. Computer analysis of video is currently implemented in a variety of fields and industries; however the term “Video Analytics” is typically associated with analysis of video streams captured by surveillance systems. Video Analytics applications can perform a variety of tasks ranging from real-time analysis of video for immediate detection of events of interest, to analysis of pre-recorded video for the purpose of extracting events and data from the recorded video (also known as forensic analysis).",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"680 tvl",
"forensic analysis",
"realtime analysis",
"recorded video",
"extracting events",
"nvr software",
"high resolution",
"prerecorded video",
"usable video",
"internet video",
"tasks ranging",
"power source",
"adds cost",
"5 mega pixels",
"fifo basis",
"proper configuration",
"accessed remotely",
"network device",
"modern dvrs",
"successfully working",
"convert analog",
"ip video",
"80211 ip network",
"ip network",
"generic term",
"hard drives",
"digital stream",
"ip video systems",
"hard drives typically",
"term video analytics",
"analog system video",
"digital video footage",
"ip stream straight",
"video streams captured",
"video cables running",
"rolling video archive",
"latest digital technology",
"analog format live",
"describe computerized processing",
"improved transmission range",
"saturated regulated frequencies",
"coax cabling back",
"todays business environments"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 17,
"imageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:27:09.812Z",
"updatedon": "2025-05-07T13:27:31.933Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/surveillance-system/17",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": "",
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5eb7e558303897fc3977",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Sensors ",
"description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"early detection",
"fire increases",
"flame phenomena",
"optical equipment",
"detecting flames",
"dangerous gas",
"alert people",
"audible alarm",
"detect fires",
"detect smoke",
"industrial premises",
"air moving",
"combined signal",
"optical smoke",
"operation rateofrise",
"main classifications",
"rate flow",
"element regulate",
"smoke alarm",
"heat detectors",
"projected beam",
"areas unaffected",
"thermal mass",
"smoke detector",
"heat detector",
"fire beam detector",
"sensors smoke detector",
"separate heat signal",
"heat sensitive element",
"thermistor temperature sensors",
"detects smoke typically",
"large areas typically",
"convicted thermal energy",
"cost effective means",
"ventilation hvac ducts"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 12,
"imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:23:03.791Z",
"updatedon": "2025-05-07T13:23:03.792Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/sensors-/12",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5e3072012f94c5cd0c02",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Addressable / Intelligent FAS",
"description": "An intelligent fire alarm system is designed to provide more efficient detection and prevention. Each intelligent device (smoke detector, heat detector, manual pull station, etc.) has its own unique “address.” If an intelligent device is transferred to an “alarm” state, it activates the fire horns and strobes. When the local fire department arrives, the control panel displays the specific device and area in which the activation occurred. (A conventional zone panel only identifies the general area of an activated device.)",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"general area",
"activated device",
"activation occurred",
"specific device",
"fire horns",
"alarm state",
"intelligent device",
"unique address",
"efficient detection",
"conventional zone panel",
"control panel displays"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 10,
"imageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:20:48.95Z",
"updatedon": "2025-05-07T13:20:48.951Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/addressable-intelligent-fas/10",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5d9d6925cdc24b7681c5",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Foam water sprinkler",
"description": "Designing a foam fire suppression system requires special expertise\n\nLow Expansion Foam\n\nLow Expansion foam offers a 5:1 expansion rate, making it the foam system of choice to protect large and hazardous facilities, including; petro-chemical tank farms, loading docks, processing areas and refineries and liquefied natural gas storage.\n\nHigh Expansion Foam\n\nWith an expansion rate of 500:1, High Expansion foam systems are more suitable to protect less common three-dimensional hazardous facilities including; warehouses, conveyors, aircraft hangars and tunnels. As such, High Expansion foam is measured by volume output rather than application rate, as is typical of low expansion foams.\n\nDischarge Devices\n\nWith both low and high expansion foam systems, once a facility has been evaluated either an ‘Aspirating’ or ‘Non-Aspirating’ discharge device’ will be recommended, based on the facilities requirements.\n\nAspirating discharge devices – produces a more viscous foam – great for reducing burn back and keeping the foam contained.\nNon-aspirating discharge devices – are best used where the foam is needed to spread over a large area. Talk to a Wormald specialist about your situation.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"wormald specialist",
"recommended based",
"application rate",
"volume output",
"hazardous facilities",
"protect large",
"foam system",
"expansion rate",
"high expansion foam",
"viscous foam great",
"foam water sprinklerdesigning",
"large area talk",
"reducing burn back",
"nonaspirating discharge device"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 8,
"imageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:18:21.329Z",
"updatedon": "2025-05-07T13:18:21.329Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/foam-water-sprinkler/8",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Sprinkler System",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
}
],
"hasmoreitems": false,
"isapirequest": false,
"totalresults": 24,
"query": null,
"floatingpoint": null
}