Home> Products> fire sealant materials for buildings

{ "products": [ { "_id": "681b5eb7e558303897fc3977", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Sensors ", "description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "early detection", "fire increases", "flame phenomena", "optical equipment", "detecting flames", "dangerous gas", "alert people", "audible alarm", "detect fires", "detect smoke", "industrial premises", "air moving", "combined signal", "optical smoke", "operation rateofrise", "main classifications", "rate flow", "element regulate", "smoke alarm", "heat detectors", "projected beam", "areas unaffected", "thermal mass", "smoke detector", "heat detector", "fire beam detector", "sensors smoke detector", "separate heat signal", "heat sensitive element", "thermistor temperature sensors", "detects smoke typically", "large areas typically", "convicted thermal energy", "cost effective means", "ventilation hvac ducts" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 12, "imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:23:03.791Z", "updatedon": "2025-05-07T13:23:03.792Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/sensors-/12", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5de53a26099a76a38090", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire Detection and Alarm", "description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": null, "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 9, "imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:19:33.065Z", "updatedon": "2025-05-07T13:19:33.066Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/fire-detection-and-alarm/9", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6329f619d1f5f02ff84f", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "AMC ", "description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": null, "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 24, "imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:42:01.786Z", "updatedon": "2025-05-07T13:42:01.787Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/amc-/24", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Services & Maintenances", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6163bd1f50f146548db6", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Gas Suppression", "description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "90 percent", "625 percent", "discharge nozzle", "hazard area", "agent reaches", "effective means", "modular hardware", "fm200novec 1230 system", "propelling mechanism", "concentration range", "data processing", "computer servers", "requires minimal space" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 21, "imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:34:27.743Z", "updatedon": "2025-05-07T13:34:27.744Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/gas-suppression/21", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60b44d3fb9d238d49dde", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Server Room Protection", "description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "small fire", "critical facilities", "sensitive electronics", "catastrophic loss", "early stages", "detect alert", "obligatory part", "server room", "damaging highvalue equipment", "server room design", "interrupting vital operations", "computercontrolled manufacturing operations" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 20, "imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:31:32.102Z", "updatedon": "2025-05-07T13:31:32.102Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/server-room-protection/20", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5f864d3fb9d238d49da6", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Security Systems", "description": "Security Systems: A security alarm is a system designed to detect intrusion – unauthorized entry – into a building or area. Security alarms are used in residential, commercial, industrial, and military properties for protection against burglary (theft) or property damage, as well as personal protection against intruders.\n\nSome alarm systems serve a single purpose of burglary protection; combination systems provide both fire and intrusion protection. Intrusion alarm systems may also be combined with closed-circuit television surveillance systems to automatically record the activities of intruders, and may interface to access control systems for electrically locked doors. Systems range from small, self-contained noisemakers, to complicated, multi-area systems with computer monitoring and control.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "personal protection", "computer monitoring", "automatically record", "single purpose", "property damage", "burglary theft", "military properties", "system designed", "security alarm", "access control systems", "alarm systems serve", "area security alarms", "security systemssecurity systems", "complicated multiarea systems", "small selfcontained noisemakers", "residential commercial industrial" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 16, "imageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:26:30.58Z", "updatedon": "2025-05-07T13:26:30.58Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/security-systems/16", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Security Systems", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5f295d31b5f2e0d46da8", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Public Address & Voice Alarm Systems", "description": "Public Address / Talk back System:\n\nA Public Address (PA) system is a collection of audio equipment that allows broadcasts over a designated area. Often found in schools and office buildings, PA systems can be used for general announcements or emergency information, providing a simple way to get information out quickly. PA systems can be basic or advanced, and people can customize them to fit a variety of needs.\n\nBasic PA systems are comprised of loudspeakers placed in convenient locations, an amplifier to increase the sound, and a mixer that adjusts audio levels. The user speaks into a microphone, and the sound is transmitted through connected cables, or a wireless system, out through the speakers. Some systems also include microphones or intercoms near the speaker locations, allowing the listener to reply to the central location. These responses are not broadcast to the entire system, however, but only to the main user area.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "entire system", "central location", "wireless system", "connected cables", "general announcements", "user speaks", "convenient locations", "designated area", "audio equipment", "basic pa systems", "main user area", "emergency information providing", "quickly pa systems", "speaker locations allowing", "adjusts audio levels" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 14, "imageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:24:57.042Z", "updatedon": "2025-05-07T13:24:57.043Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/public-address-voice-alarm-systems/14", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Evacuation System", "tags": [], "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5eecc848881bcc166545", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Evacuation System", "description": "Fire alarm voice evacuation system uses speakers and amplifiers to notify occupants with an alarm tone followed by a voice instead of the traditional horn or bell. Also provides ability for live voice announcements by the fire department or emergency personnel through a local paging microphone. These voice evacuation systems are most commonly installed in two types of building occupancies:\n\nPlace of Assembly: Where more than 50 people congregate, but may be unfamiliar with exit locations, or fire emergency signals, voice systems can instruct people to remain calm, and to evacuate the building.\nHigh Rise: When it is impractical to evacuate a building in its entirety, zoned evacuation of the occupants is used to conduct an instructed evacuation of floors or areas within the building.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "notify occupants", "remain calm", "instruct people", "exit locations", "50 people congregate", "commonly installed", "emergency personnel", "fire department", "traditional horn", "alarm tone", "instructed evacuation", "building high rise", "building occupancies place", "voice evacuation systems", "live voice announcements", "entirety zoned evacuation", "local paging microphone" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 13, "imageuri": "https://bizimages.withfloats.com/actual/153b10c135934fdd982db0b6b22f117f.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/153b10c135934fdd982db0b6b22f117f.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:23:56.721Z", "updatedon": "2025-05-07T13:23:56.722Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/evacuation-system/13", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Evacuation System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d9d6925cdc24b7681c5", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Foam water sprinkler", "description": "Designing a foam fire suppression system requires special expertise\n\nLow Expansion Foam\n\nLow Expansion foam offers a 5:1 expansion rate, making it the foam system of choice to protect large and hazardous facilities, including; petro-chemical tank farms, loading docks, processing areas and refineries and liquefied natural gas storage.\n\nHigh Expansion Foam\n\nWith an expansion rate of 500:1, High Expansion foam systems are more suitable to protect less common three-dimensional hazardous facilities including; warehouses, conveyors, aircraft hangars and tunnels. As such, High Expansion foam is measured by volume output rather than application rate, as is typical of low expansion foams.\n\nDischarge Devices\n\nWith both low and high expansion foam systems, once a facility has been evaluated either an ‘Aspirating’ or ‘Non-Aspirating’ discharge device’ will be recommended, based on the facilities requirements.\n\nAspirating discharge devices – produces a more viscous foam – great for reducing burn back and keeping the foam contained.\nNon-aspirating discharge devices – are best used where the foam is needed to spread over a large area. Talk to a Wormald specialist about your situation.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "wormald specialist", "recommended based", "application rate", "volume output", "hazardous facilities", "protect large", "foam system", "expansion rate", "high expansion foam", "viscous foam great", "foam water sprinklerdesigning", "large area talk", "reducing burn back", "nonaspirating discharge device" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 8, "imageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:18:21.329Z", "updatedon": "2025-05-07T13:18:21.329Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/foam-water-sprinkler/8", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }