Home> Products> fire detection and suppression systems

{ "products": [ { "_id": "681b5de53a26099a76a38090", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire Detection and Alarm", "description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": null, "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 9, "imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:19:33.065Z", "updatedon": "2025-05-07T13:19:33.066Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/fire-detection-and-alarm/9", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6329f619d1f5f02ff84f", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "AMC ", "description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": null, "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 24, "imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:42:01.786Z", "updatedon": "2025-05-07T13:42:01.787Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/amc-/24", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Services & Maintenances", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5cf1bc744980d54e15b4", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Deluge System", "description": "A deluge system is similar to a pre-action system except the sprinkler heads are open and the pipe is not pressurized with air. Deluge systems are connected to a water supply through a deluge valve that is opened by the operation of a smoke or heat detection system. The detection system is installed in the same area as the sprinklers. When the detection system is activated water discharges through all of the sprinkler heads in the system. Deluge systems are used in places that are considered high hazard areas such as power plants, aircraft hangars and chemical storage or processing facilities. Deluge systems are needed where high velocity suppression is necessary to prevent fire spread.\n\nDeluge Fire Sprinkler Systems differ from conventional Fire Sprinkler Systems in the sense that all sprinkles or nozzles employed in the system are open and when water is released into the system it flows from all discharge devices. As such, this special type of system is generally found within industrial type hazards that require the application of water over a large hazard or area. The control of water is accomplished by the use of a Deluge Valve which is a device that prevents water from entering the system piping until required. A detection system which may incorporate the use of heat, smoke, or flame detectors is used to open the Deluge Valve when a fire or its products of combustion are detected. All system piping is filled with water which discharges from the open sprinklers and nozzles used in the system. In addition to the application of water some deluge systems will incorporate the use of a foam concentrate to mix with water and form a foam solution which can then provide a protective blanket of foam to help control the development of a fire.\nDeluge Fire Sprinkler systems protect extra hazard occupancies that require significant amounts of water to cool and control the growth or development of a fire. Typically they are employed on hazards that contain low flash point flammable liquids or hazards with large amounts of combustible liquids. These types of hazards may include, oil extraction processes, transformers, tank or vessel protection, distillation processes. Water or Foam Deluge systems are used in the protection of large Aircraft Hangers as one primary means of fire protection.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "open sprinklers", "nozzles employed", "fire protection", "prevents water", "water supply", "fire typically", "system piping", "preaction system", "primary means", "combustible liquids", "protective blanket", "foam solution", "foam concentrate", "flame detectors", "heat smoke", "generally found", "discharge devices", "chemical storage", "sprinkler heads", "detection system", "large hazard", "deluge valve", "special type", "large amounts", "deluge systems", "activated water discharges", "heat detection system", "industrial type hazards", "system deluge systems", "foam deluge systems", "require significant amounts", "air deluge systems", "large aircraft hangers", "high velocity suppression" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 6, "imageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:15:29.727Z", "updatedon": "2025-05-07T13:15:29.728Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/deluge-system/6", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d9d6925cdc24b7681c5", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Foam water sprinkler", "description": "Designing a foam fire suppression system requires special expertise\n\nLow Expansion Foam\n\nLow Expansion foam offers a 5:1 expansion rate, making it the foam system of choice to protect large and hazardous facilities, including; petro-chemical tank farms, loading docks, processing areas and refineries and liquefied natural gas storage.\n\nHigh Expansion Foam\n\nWith an expansion rate of 500:1, High Expansion foam systems are more suitable to protect less common three-dimensional hazardous facilities including; warehouses, conveyors, aircraft hangars and tunnels. As such, High Expansion foam is measured by volume output rather than application rate, as is typical of low expansion foams.\n\nDischarge Devices\n\nWith both low and high expansion foam systems, once a facility has been evaluated either an ‘Aspirating’ or ‘Non-Aspirating’ discharge device’ will be recommended, based on the facilities requirements.\n\nAspirating discharge devices – produces a more viscous foam – great for reducing burn back and keeping the foam contained.\nNon-aspirating discharge devices – are best used where the foam is needed to spread over a large area. Talk to a Wormald specialist about your situation.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "wormald specialist", "recommended based", "application rate", "volume output", "hazardous facilities", "protect large", "foam system", "expansion rate", "high expansion foam", "viscous foam great", "foam water sprinklerdesigning", "large area talk", "reducing burn back", "nonaspirating discharge device" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 8, "imageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:18:21.329Z", "updatedon": "2025-05-07T13:18:21.329Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/foam-water-sprinkler/8", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d2a701ce9d7e115dce8", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Water Spray systems", "description": "Water spray nozzles are designed to spray water directly onto the hazard surface via a series of nozzles with a carefully predetermined spray pattern. They are suitable for a variety of special hazards including transformer, turbines and combustible liquid hazards and systems can be individually tailored to your needs.\n\nHigh velocity systems – getting under the fire\n\nHigh velocity systems are often used to protect equipment that incorporate heavy or medium oils; equipment such as transformers, circuit breakers, diesel engines and fuel oil storage tanks, turbo alternator lube oil systems and oil fired boilers.\n\nThe high velocity nozzles are specifically designed to discharge a jet of water at high speed. The water jet forms a cone of coarse spray of uniform density which is discharged over a defined area. The coarse spray is able to penetrate the flame zone and reach the surface of the burning oil. The turbulence created by the high velocity spray forms an oil-in-water emulsion on the surface of the oil that will not burn. This “emulsification” is the principal way the fire is extinguished, along with a cooling and smothering effect.\n\nThe shape of the spray cone, the fire area contacted and the water flow is all controlled by the nozzle specifications – the orifice size and the shape of the internal swirl plate – along with the water pressure and the orientation of the nozzle.\n\nMedium velocity systems – cooling fire down\n\nMedium velocity sprayers discharge a water spray of finely divided droplets at medium velocity. They are ideal for protecting hazards involving light oils where emulsification from high velocity sprayers is not possible. The fine spray has a high heat absorption rate so medium velocity sprayers are an effective method of protecting adjacent plant and structures from heat during a fire by providing a continuous cooling spray over the exposed surfaces. Keeping nearby equipment cool minimises damage and reduces the risk of explosion.\n\nMedium velocity sprayers can be used in combination with other fire fighting systems – dry chemical and foam can be used effectively under the discharge. The fine spray also works to dilute and disperse flammable vapours. The sprayers use an external deflector to achieve the desired discharge angle and spray characteristics", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "hazard surface", "specifically designed", "spray cone", "external deflector", "effective method", "orifice size", "nozzle specifications", "smothering effect", "oilinwater emulsion", "turbulence created", "burning oil", "flame zone", "uniform density", "incorporate heavy", "individually tailored", "transformer turbines", "water pressure", "water flow", "spray characteristics", "fine spray", "coarse spray", "water spray", "defined area", "protect equipment", "special hazards", "high speed", "medium velocity", "water jet forms", "fire area contacted", "continuous cooling spray", "spray water directly", "high velocity nozzles", "high velocity systems", "desired discharge angle", "medium velocity sprayers", "high velocity sprayers", "oil fired boilers", "medium oils equipment", "combustible liquid hazards", "disperse flammable vapours", "protecting adjacent plant", "finely divided droplets", "internal swirl plate" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 7, "imageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:16:26.609Z", "updatedon": "2025-05-07T13:16:26.609Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/water-spray-systems/7", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5c35944888e973c896f5", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Pre-action System", "description": "Pre-action fire sprinkler systems employ the basic concept of a dry pipe system in that water is not normally contained within the pipes. The difference, however, is that water is held from piping by an electrically operated valve, known as a pre-action valve. Valve operation is controlled by independent flame, heat, or smoke detection.\n\nTwo separate events must happen to initiate sprinkler discharge. First, the detection system must identify a developing fire and then open the pre-action valve. This allows water to flow into system piping, which effectively creates a wet pipe sprinkler system. Second, individual sprinkler heads must release to permit water flow onto the fire.\n\nIn some instances, the pre-action system may be set up with a double interlock in which pressurized air or nitrogen is added to system piping. The purpose of this feature is two-fold: first to monitor piping for leaks and second to hold water from system piping in the event of inadvertent detector operation. The most common application for this system type is in freezer warehouses.\n\nAdvantages of using pre-action fire sprinkler systems include:\n\nThe dual action required for water release – The pre-action valve must operate and sprinkler heads must fuse. This feature provides an added level of protection against inadvertent discharge. For this reason, pre-action systems are frequently employed in water sensitive environments such as archival vaults, fine art storage rooms, rare book libraries and computer centers.\nDisadvantages of using pre-action fire sprinkler systems include:\n\nHigher installation and maintenance costs – Pre-action systems are more complex with several additional components, notably a fire detection system. This adds to the overall system cost.\nModification difficulties – As with dry-pipe systems, pre-action sprinkler systems have specific size limitations which may impact future system modifications. In addition, system modifications must incorporate changes to the fire detection and control system to ensure proper operation.\nPotential decreased reliability – The higher level of complexity associated with pre-action systems creates an increased chance that something may not work when needed. Regular maintenance is essential to ensure reliability", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "water release", "added level", "monitor piping", "hold water", "ensure reliability", "increased chance", "higher level", "higher installation", "frequently employed", "common application", "pressurized air", "double interlock", "developing fire", "separate events", "basic concept", "system piping", "fire detection", "smoke detection", "control system", "system type", "effectively creates", "detection system", "preaction system", "preaction valve", "inadvertent discharge", "sprinkler heads", "fire detection system", "permit water flow", "water sensitive environments", "preaction systems creates", "individual sprinkler heads", "initiate sprinkler discharge", "addition system modifications", "dry pipe system", "electrically operated valve", "reason preaction systems", "inadvertent detector operation", "needed regular maintenance", "specific size limitations", "additional components notably", "computer centers disadvantages", "dual action required", "freezer warehouses advantages", "independent flame heat" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 5, "imageuri": "https://bizimages.withfloats.com/actual/a2b28c13a31c434f8b0831ddd429b1d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a2b28c13a31c434f8b0831ddd429b1d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:12:21.517Z", "updatedon": "2025-05-07T13:12:21.518Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/pre-action-system/5", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5a0b4149ed1d2b01feec", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Wet Sprinkler System", "description": "Wet pipe systems are the most common fire sprinkler system. A wet pipe system is one in which water is constantly maintained within the sprinkler piping. When a sprinkler activates this water is immediately discharged onto the fire.\n\nAdvantages to using a wet pipe fire sprinkler system include:\n\nSystem simplicity and reliability – Wet pipe sprinkler systems have the least number of components and therefore, the lowest number of items to malfunction. This produces unexcelled reliability which is important since sprinklers may be asked to sit in waiting for many years before they are needed. This simplicity aspect also becomes important in facilities where system maintenance may not be performed with the desired frequency.\nRelative low installation and maintenance expense – Due to their overall simplicity, wet pipe sprinklers require the least amount of installation time and capital. Maintenance cost savings are also realized since less service time is generally required compared to other system types. These savings become important when maintenance budgets are shrinking.\nEase of modification – Wet pipe fire sprinkler systems are advantageous since modifications involve shutting down the water supply, draining pipes and making alterations. Following the work, the system is pressure tested and restored. Additional work for detection and special control equipment is avoided which again saves time and expense.\nShort term down time following a fire – Wet pipe sprinkler systems require the least amount of effort to restore. In most instances, sprinkler protection is reinstated by replacing the fused sprinklers and turning the water supply back on. Pre-action and dry-pipe systems may require additional effort to reset control equipment.\nDisadvantages to using a wet pipe fire sprinkler system include:\n\nWet pipe systems are not suited for sub-freezing environments.\n\nThere may also be a concern where piping is subject to severe impact damage and could consequently leak.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "fused sprinklers", "lowest number", "saves time", "service time", "installation time", "sprinkler piping", "subfreezing environments", "pressure tested", "making alterations", "shrinking ease", "system types", "simplicity aspect", "system simplicity", "fire advantages", "immediately discharged", "constantly maintained", "maintenance budgets", "system maintenance", "sprinkler activates", "drypipe systems", "water supply back", "require additional effort", "restored additional work", "wet pipe system", "instances sprinkler protection", "maintenance expense due", "wet pipe systems", "severe impact damage", "expense short term", "special control equipment", "modifications involve shutting", "generally required compared", "produces unexcelled reliability" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 3, "imageuri": "https://bizimages.withfloats.com/actual/53b1e1444fa84a9eaf0eeb3ee4b3e81d.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/53b1e1444fa84a9eaf0eeb3ee4b3e81d.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:03:07.499Z", "updatedon": "2025-05-07T13:03:07.5Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/wet-sprinkler-system/3", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6163bd1f50f146548db6", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Gas Suppression", "description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "90 percent", "625 percent", "discharge nozzle", "hazard area", "agent reaches", "effective means", "modular hardware", "fm200novec 1230 system", "propelling mechanism", "concentration range", "data processing", "computer servers", "requires minimal space" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 21, "imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:34:27.743Z", "updatedon": "2025-05-07T13:34:27.744Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/gas-suppression/21", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60731670c79d70e49a22", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Intrusion Systems", "description": "Intruder detection systems are an integral element in your security management system. Security performance enhancements and cost savings can be achieved by combining intrusion alarm systems together with video surveillance and access control. Siemens embraces this shift in mindset and its intruder detection systems that can be integrated and even monitored by one central management station (Surveillance Fusion).\n\nThe Other various elements involved in this are\n\nPIR – Pet Immune passive infrared sensor\nMotion Sensor 360deg\nGlass break sensor", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "elements involved", "video surveillance", "cost savings", "integral element", "intruder detection systems" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 19, "imageuri": "https://bizimages.withfloats.com/actual/24e36ff5d81448d9a976ed96f39ca792.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/24e36ff5d81448d9a976ed96f39ca792.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:30:27.635Z", "updatedon": "2025-05-07T13:30:27.636Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/products/intrusion-systems/19", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Security Systems", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }