Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360
android app
/
iOS App/ web portal.
{
"products": [
{
"_id": "681b5fadab7a210d40661fb1",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Surveillance System",
"description": "Video surveillance delivers unprecedented abilities to monitor and manage the risks of today’s business environments. These easy to use systems are successfully working to help reduce theft, workplace violence, and fraudulent workman’s compensation claims.\n\nAnalog System : Cameras on an analog CCTV system send their video in the traditional base band format over coax cabling back to a digital video recorder (DVR). Here, video is digitized and stored on hard drives. Most modern DVRs are a network device, and as such can be accessed remotely from the LAN, or with the proper configuration, from across a WAN or the internet. Video is kept on hard drives, typically on a FIFO basis so there is always a rolling video archive of the past X days. So, despite the fact that video is being transmitted from the cameras in an analog format, live and recorded video is still available over the network.\nIP Video System : IP video cameras broadcast their video as a digital stream over an IP network. Like an analog system, video is recorded on hard drives, but since the video is an IP stream straight from the camera, there is more flexibility as to how and where that video is recorded. The DVR is replaced with an NVR (network video recorder), which in some cases is just software since it doesn’t need to convert analog to digital. Video footage can then be stored on new or existing network RAID drives as directed by the NVR software.\n\nAnd the biggest factors driving interest in IP video systems is the high resolution that they can offer. Analog cameras max out on resolution at about 680 TVL which equates to roughly 0.6 mega pixels. High end IP cameras on the other hand, are currently available at resolutions above 5 mega pixels. This high resolution in turn gives users the ability to zoom in on video after the fact, and still have usable video.\n\nAnother benefit to IP video is that it is much more compatible with wireless. Wireless analog systems are available, but they either have to convert to IP anyway and broadcast over the 802.11 IP network (which adds cost for encoders), or they get crammed onto the over saturated regulated frequencies and often encounter interference.\n\nWireless security camera systems: it take away the worry of video cables running around your property all you need is a power source. Using the latest digital technology, some wireless CCTV cameras offer an improved transmission range of up to 200m. Although these cameras are often easier to install and move around than wired ones.\nVideo Analytics (Management): Video Analytics, also referred to as Video Content Analysis (VCA), is a generic term used to describe computerized processing and analysis of video streams. Computer analysis of video is currently implemented in a variety of fields and industries; however the term “Video Analytics” is typically associated with analysis of video streams captured by surveillance systems. Video Analytics applications can perform a variety of tasks ranging from real-time analysis of video for immediate detection of events of interest, to analysis of pre-recorded video for the purpose of extracting events and data from the recorded video (also known as forensic analysis).",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"680 tvl",
"forensic analysis",
"realtime analysis",
"recorded video",
"extracting events",
"nvr software",
"high resolution",
"prerecorded video",
"usable video",
"internet video",
"tasks ranging",
"power source",
"adds cost",
"5 mega pixels",
"fifo basis",
"proper configuration",
"accessed remotely",
"network device",
"modern dvrs",
"successfully working",
"convert analog",
"ip video",
"80211 ip network",
"ip network",
"generic term",
"hard drives",
"digital stream",
"ip video systems",
"hard drives typically",
"term video analytics",
"analog system video",
"digital video footage",
"ip stream straight",
"video streams captured",
"video cables running",
"rolling video archive",
"latest digital technology",
"analog format live",
"describe computerized processing",
"improved transmission range",
"saturated regulated frequencies",
"coax cabling back",
"todays business environments"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 17,
"imageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:27:09.812Z",
"updatedon": "2025-05-07T13:27:31.933Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/surveillance-system/17",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": "",
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5f295d31b5f2e0d46da8",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Public Address & Voice Alarm Systems",
"description": "Public Address / Talk back System:\n\nA Public Address (PA) system is a collection of audio equipment that allows broadcasts over a designated area. Often found in schools and office buildings, PA systems can be used for general announcements or emergency information, providing a simple way to get information out quickly. PA systems can be basic or advanced, and people can customize them to fit a variety of needs.\n\nBasic PA systems are comprised of loudspeakers placed in convenient locations, an amplifier to increase the sound, and a mixer that adjusts audio levels. The user speaks into a microphone, and the sound is transmitted through connected cables, or a wireless system, out through the speakers. Some systems also include microphones or intercoms near the speaker locations, allowing the listener to reply to the central location. These responses are not broadcast to the entire system, however, but only to the main user area.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"entire system",
"central location",
"wireless system",
"connected cables",
"general announcements",
"user speaks",
"convenient locations",
"designated area",
"audio equipment",
"basic pa systems",
"main user area",
"emergency information providing",
"quickly pa systems",
"speaker locations allowing",
"adjusts audio levels"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 14,
"imageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:24:57.042Z",
"updatedon": "2025-05-07T13:24:57.043Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/public-address-voice-alarm-systems/14",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Evacuation System",
"tags": [],
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5eb7e558303897fc3977",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Sensors ",
"description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"early detection",
"fire increases",
"flame phenomena",
"optical equipment",
"detecting flames",
"dangerous gas",
"alert people",
"audible alarm",
"detect fires",
"detect smoke",
"industrial premises",
"air moving",
"combined signal",
"optical smoke",
"operation rateofrise",
"main classifications",
"rate flow",
"element regulate",
"smoke alarm",
"heat detectors",
"projected beam",
"areas unaffected",
"thermal mass",
"smoke detector",
"heat detector",
"fire beam detector",
"sensors smoke detector",
"separate heat signal",
"heat sensitive element",
"thermistor temperature sensors",
"detects smoke typically",
"large areas typically",
"convicted thermal energy",
"cost effective means",
"ventilation hvac ducts"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 12,
"imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:23:03.791Z",
"updatedon": "2025-05-07T13:23:03.792Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/sensors-/12",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5de53a26099a76a38090",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Fire Detection and Alarm",
"description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": null,
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 9,
"imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:19:33.065Z",
"updatedon": "2025-05-07T13:19:33.066Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/fire-detection-and-alarm/9",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6329f619d1f5f02ff84f",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "AMC ",
"description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": null,
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 24,
"imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:42:01.786Z",
"updatedon": "2025-05-07T13:42:01.787Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/amc-/24",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Services & Maintenances",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6220e66948a919653f2f",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Fire extinguisher",
"description": "A Fire extinguisher is a device which can be used to control a fire. Fire extinguishers can help remove the fire, and may stop it from burning. Depending on the size, some fire extinguishers can be carried around and operated by hand. There are different kinds of fire extinguishers. Different kinds of fire can be controlled by different substances Classfication of Fire Extinguishers\n\nClass A fires involve organic solids such as paper and wood.\nClass B fires involve flammable or combustible liquids, including petrol, grease, and oil.\nClass C fires involve flammable gases.\nClass D fires involve combustible metals.\nClass E fires involve electrical equipment/appliances.\nClass F fires involve cooking fat and oil.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"oil class",
"petrol grease",
"combustible liquids",
"substances classfication",
"burning depending",
"wood class",
"fire extinguishers",
"fire fire extinguishers",
"fire extinguishers class",
"fires involve flammable"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 23,
"imageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:37:36.166Z",
"updatedon": "2025-05-07T13:37:36.166Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/fire-extinguisher/23",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire extinguisher",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b61def36ed9034d8fc8e1",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Water Leak Detection",
"description": "Water leaks can cause great damage to your property especially when it comes to electronics. A water detection sensor detects the presence of water before it contacts electronics or other valuables in the room. Use a leak detection sensor having a water sensor alarm to protect your property. When the leak detection equipment senses a leakage, the property manager is notified immediately so that action to remedy the cause can be taken as soon as possible.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"property manager",
"contacts electronics",
"notified immediately",
"great damage",
"water sensor alarm",
"leak detection sensor"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 22,
"imageuri": "https://bizimages.withfloats.com/actual/64ab299783ef4ba59557095991ef881d.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/64ab299783ef4ba59557095991ef881d.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:36:30.703Z",
"updatedon": "2025-05-07T13:36:30.703Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/water-leak-detection/22",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Server Room Protection",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6163bd1f50f146548db6",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Gas Suppression",
"description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"90 percent",
"625 percent",
"discharge nozzle",
"hazard area",
"agent reaches",
"effective means",
"modular hardware",
"fm200novec 1230 system",
"propelling mechanism",
"concentration range",
"data processing",
"computer servers",
"requires minimal space"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 21,
"imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:34:27.743Z",
"updatedon": "2025-05-07T13:34:27.744Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/gas-suppression/21",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Server Room Protection",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b60b44d3fb9d238d49dde",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT3424",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Server Room Protection",
"description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"small fire",
"critical facilities",
"sensitive electronics",
"catastrophic loss",
"early stages",
"detect alert",
"obligatory part",
"server room",
"damaging highvalue equipment",
"server room design",
"interrupting vital operations",
"computercontrolled manufacturing operations"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 20,
"imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:31:32.102Z",
"updatedon": "2025-05-07T13:31:32.102Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/products/server-room-protection/20",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Server Room Protection",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
}
],
"hasmoreitems": false,
"isapirequest": false,
"totalresults": 24,
"query": null,
"floatingpoint": null
}