Home> Products> iot and ai fire detection

{ "products": [ { "_id": "681b5de53a26099a76a38095", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire Detection and Alarm", "description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "building occupants", "alert people", "initiating device", "aircraft hangers", "computer rooms", "whats referred", "harmful levels", "hear sounders", "ambient noise", "vision impaired", "hearing impaired", "pull stations", "detects things", "maintenance area", "generally inside", "communication ports", "modern facps", "turn decides", "decipher messages", "remotely monitored", "notification device", "notification appliance", "firedetection system", "evac system", "system easier", "system troubles", "initiating devices", "fire detection", "notification appliances", "fire alarm", "fire alarm system", "common notification appliances", "notification devices connected", "hospital operating rooms", "fire alarm manually", "preaction suppression system", "prerecorded evacuation plan", "water flow detectors", "electrical room office", "keypads lcd screens" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 9, "imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:19:33.065Z", "updatedon": "2025-05-07T13:19:33.066Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//fire-detection-and-alarm/9", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6329f619d1f5f02ff854", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "AMC ", "description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "call ready", "service calls", "protected property", "property housed", "night technicians", "technicians aim", "dispatch call", "breakdown call", "addition safelincs", "supervisory signals", "longer meets", "existing space", "issues recommendations", "operations explanation", "older equipment", "alarm dealer", "sprinkler malfunction", "business owners", "quick response", "past inspection", "instant access", "properly repair", "routine inspection", "testing inspecting", "valuable assets", "companies protect", "successful companies", "testing today", "current crisis", "matter day", "manufacturers equipment", "organizations large", "huge range", "save lives", "stateoftheart systems", "fireprotection systems", "detection systems", "system improvement", "signals received", "emergency response", "emergency time", "fire restoring", "fire suppression", "refresher training", "protected facility", "national team", "provide peace", "fire systems", "provide training", "safelincs training safelincs", "fire protection systems", "fire alarms safelincs", "regular maintenance services", "clients facility team", "system application sequence", "system components understanding", "system discharges protecting", "system problem presents", "world trust safelincs", "trouble signals records", "undertake emergency repairs", "local fire department", "required training topics", "provide unmatched performance", "provide online support", "tested regularly inspected", "avoid future problems", "mission critical processes" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 24, "imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:42:01.786Z", "updatedon": "2025-05-07T13:42:01.787Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/amc-/24", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Services & Maintenances", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5eb7e558303897fc397c", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Sensors ", "description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "early detection", "fire increases", "flame phenomena", "optical equipment", "detecting flames", "dangerous gas", "alert people", "audible alarm", "detect fires", "detect smoke", "industrial premises", "air moving", "combined signal", "optical smoke", "operation rateofrise", "main classifications", "rate flow", "element regulate", "smoke alarm", "heat detectors", "projected beam", "areas unaffected", "thermal mass", "smoke detector", "heat detector", "fire beam detector", "sensors smoke detector", "separate heat signal", "heat sensitive element", "thermistor temperature sensors", "detects smoke typically", "large areas typically", "convicted thermal energy", "cost effective means", "ventilation hvac ducts" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 12, "imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:23:03.791Z", "updatedon": "2025-05-07T13:23:03.792Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/sensors-/12", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5cf1bc744980d54e15b9", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Deluge System", "description": "A deluge system is similar to a pre-action system except the sprinkler heads are open and the pipe is not pressurized with air. Deluge systems are connected to a water supply through a deluge valve that is opened by the operation of a smoke or heat detection system. The detection system is installed in the same area as the sprinklers. When the detection system is activated water discharges through all of the sprinkler heads in the system. Deluge systems are used in places that are considered high hazard areas such as power plants, aircraft hangars and chemical storage or processing facilities. Deluge systems are needed where high velocity suppression is necessary to prevent fire spread.\n\nDeluge Fire Sprinkler Systems differ from conventional Fire Sprinkler Systems in the sense that all sprinkles or nozzles employed in the system are open and when water is released into the system it flows from all discharge devices. As such, this special type of system is generally found within industrial type hazards that require the application of water over a large hazard or area. The control of water is accomplished by the use of a Deluge Valve which is a device that prevents water from entering the system piping until required. A detection system which may incorporate the use of heat, smoke, or flame detectors is used to open the Deluge Valve when a fire or its products of combustion are detected. All system piping is filled with water which discharges from the open sprinklers and nozzles used in the system. In addition to the application of water some deluge systems will incorporate the use of a foam concentrate to mix with water and form a foam solution which can then provide a protective blanket of foam to help control the development of a fire.\nDeluge Fire Sprinkler systems protect extra hazard occupancies that require significant amounts of water to cool and control the growth or development of a fire. Typically they are employed on hazards that contain low flash point flammable liquids or hazards with large amounts of combustible liquids. These types of hazards may include, oil extraction processes, transformers, tank or vessel protection, distillation processes. Water or Foam Deluge systems are used in the protection of large Aircraft Hangers as one primary means of fire protection.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "open sprinklers", "nozzles employed", "fire protection", "prevents water", "water supply", "fire typically", "system piping", "preaction system", "primary means", "combustible liquids", "protective blanket", "foam solution", "foam concentrate", "flame detectors", "heat smoke", "generally found", "discharge devices", "chemical storage", "sprinkler heads", "detection system", "large hazard", "deluge valve", "special type", "large amounts", "deluge systems", "activated water discharges", "heat detection system", "industrial type hazards", "system deluge systems", "foam deluge systems", "require significant amounts", "air deluge systems", "large aircraft hangers", "high velocity suppression" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 6, "imageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:15:29.727Z", "updatedon": "2025-05-07T13:15:29.728Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/deluge-system/6", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5c35944888e973c896fa", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Pre-action System", "description": "Pre-action fire sprinkler systems employ the basic concept of a dry pipe system in that water is not normally contained within the pipes. The difference, however, is that water is held from piping by an electrically operated valve, known as a pre-action valve. Valve operation is controlled by independent flame, heat, or smoke detection.\n\nTwo separate events must happen to initiate sprinkler discharge. First, the detection system must identify a developing fire and then open the pre-action valve. This allows water to flow into system piping, which effectively creates a wet pipe sprinkler system. Second, individual sprinkler heads must release to permit water flow onto the fire.\n\nIn some instances, the pre-action system may be set up with a double interlock in which pressurized air or nitrogen is added to system piping. The purpose of this feature is two-fold: first to monitor piping for leaks and second to hold water from system piping in the event of inadvertent detector operation. The most common application for this system type is in freezer warehouses.\n\nAdvantages of using pre-action fire sprinkler systems include:\n\nThe dual action required for water release – The pre-action valve must operate and sprinkler heads must fuse. This feature provides an added level of protection against inadvertent discharge. For this reason, pre-action systems are frequently employed in water sensitive environments such as archival vaults, fine art storage rooms, rare book libraries and computer centers.\nDisadvantages of using pre-action fire sprinkler systems include:\n\nHigher installation and maintenance costs – Pre-action systems are more complex with several additional components, notably a fire detection system. This adds to the overall system cost.\nModification difficulties – As with dry-pipe systems, pre-action sprinkler systems have specific size limitations which may impact future system modifications. In addition, system modifications must incorporate changes to the fire detection and control system to ensure proper operation.\nPotential decreased reliability – The higher level of complexity associated with pre-action systems creates an increased chance that something may not work when needed. Regular maintenance is essential to ensure reliability", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "water release", "added level", "monitor piping", "hold water", "ensure reliability", "increased chance", "higher level", "higher installation", "frequently employed", "common application", "pressurized air", "double interlock", "developing fire", "separate events", "basic concept", "system piping", "fire detection", "smoke detection", "control system", "system type", "effectively creates", "detection system", "preaction system", "preaction valve", "inadvertent discharge", "sprinkler heads", "fire detection system", "permit water flow", "water sensitive environments", "preaction systems creates", "individual sprinkler heads", "initiate sprinkler discharge", "addition system modifications", "dry pipe system", "electrically operated valve", "reason preaction systems", "inadvertent detector operation", "needed regular maintenance", "specific size limitations", "additional components notably", "computer centers disadvantages", "dual action required", "freezer warehouses advantages", "independent flame heat" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 5, "imageuri": "https://bizimages.withfloats.com/actual/a2b28c13a31c434f8b0831ddd429b1d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a2b28c13a31c434f8b0831ddd429b1d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:12:21.517Z", "updatedon": "2025-05-07T13:12:21.518Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/pre-action-system/5", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5a0b4149ed1d2b01fef1", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Wet Sprinkler System", "description": "Wet pipe systems are the most common fire sprinkler system. A wet pipe system is one in which water is constantly maintained within the sprinkler piping. When a sprinkler activates this water is immediately discharged onto the fire.\n\nAdvantages to using a wet pipe fire sprinkler system include:\n\nSystem simplicity and reliability – Wet pipe sprinkler systems have the least number of components and therefore, the lowest number of items to malfunction. This produces unexcelled reliability which is important since sprinklers may be asked to sit in waiting for many years before they are needed. This simplicity aspect also becomes important in facilities where system maintenance may not be performed with the desired frequency.\nRelative low installation and maintenance expense – Due to their overall simplicity, wet pipe sprinklers require the least amount of installation time and capital. Maintenance cost savings are also realized since less service time is generally required compared to other system types. These savings become important when maintenance budgets are shrinking.\nEase of modification – Wet pipe fire sprinkler systems are advantageous since modifications involve shutting down the water supply, draining pipes and making alterations. Following the work, the system is pressure tested and restored. Additional work for detection and special control equipment is avoided which again saves time and expense.\nShort term down time following a fire – Wet pipe sprinkler systems require the least amount of effort to restore. In most instances, sprinkler protection is reinstated by replacing the fused sprinklers and turning the water supply back on. Pre-action and dry-pipe systems may require additional effort to reset control equipment.\nDisadvantages to using a wet pipe fire sprinkler system include:\n\nWet pipe systems are not suited for sub-freezing environments.\n\nThere may also be a concern where piping is subject to severe impact damage and could consequently leak.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "fused sprinklers", "lowest number", "saves time", "service time", "installation time", "sprinkler piping", "subfreezing environments", "pressure tested", "making alterations", "shrinking ease", "system types", "simplicity aspect", "system simplicity", "fire advantages", "immediately discharged", "constantly maintained", "maintenance budgets", "system maintenance", "sprinkler activates", "drypipe systems", "water supply back", "require additional effort", "restored additional work", "wet pipe system", "instances sprinkler protection", "maintenance expense due", "wet pipe systems", "severe impact damage", "expense short term", "special control equipment", "modifications involve shutting", "generally required compared", "produces unexcelled reliability" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 3, "imageuri": "https://bizimages.withfloats.com/actual/53b1e1444fa84a9eaf0eeb3ee4b3e81d.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/53b1e1444fa84a9eaf0eeb3ee4b3e81d.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:03:07.499Z", "updatedon": "2025-05-07T13:03:07.5Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//wet-sprinkler-system/3", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60b44d3fb9d238d49de3", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Server Room Protection", "description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "small fire", "critical facilities", "sensitive electronics", "catastrophic loss", "early stages", "detect alert", "obligatory part", "server room", "damaging highvalue equipment", "server room design", "interrupting vital operations", "computercontrolled manufacturing operations" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 20, "imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:31:32.102Z", "updatedon": "2025-05-07T13:31:32.102Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/server-room-protection/20", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5fadab7a210d40661fb6", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Surveillance System", "description": "Video surveillance delivers unprecedented abilities to monitor and manage the risks of today’s business environments. These easy to use systems are successfully working to help reduce theft, workplace violence, and fraudulent workman’s compensation claims.\n\nAnalog System : Cameras on an analog CCTV system send their video in the traditional base band format over coax cabling back to a digital video recorder (DVR). Here, video is digitized and stored on hard drives. Most modern DVRs are a network device, and as such can be accessed remotely from the LAN, or with the proper configuration, from across a WAN or the internet. Video is kept on hard drives, typically on a FIFO basis so there is always a rolling video archive of the past X days. So, despite the fact that video is being transmitted from the cameras in an analog format, live and recorded video is still available over the network.\nIP Video System : IP video cameras broadcast their video as a digital stream over an IP network. Like an analog system, video is recorded on hard drives, but since the video is an IP stream straight from the camera, there is more flexibility as to how and where that video is recorded. The DVR is replaced with an NVR (network video recorder), which in some cases is just software since it doesn’t need to convert analog to digital. Video footage can then be stored on new or existing network RAID drives as directed by the NVR software.\n\nAnd the biggest factors driving interest in IP video systems is the high resolution that they can offer. Analog cameras max out on resolution at about 680 TVL which equates to roughly 0.6 mega pixels. High end IP cameras on the other hand, are currently available at resolutions above 5 mega pixels. This high resolution in turn gives users the ability to zoom in on video after the fact, and still have usable video.\n\nAnother benefit to IP video is that it is much more compatible with wireless. Wireless analog systems are available, but they either have to convert to IP anyway and broadcast over the 802.11 IP network (which adds cost for encoders), or they get crammed onto the over saturated regulated frequencies and often encounter interference.\n\nWireless security camera systems: it take away the worry of video cables running around your property all you need is a power source. Using the latest digital technology, some wireless CCTV cameras offer an improved transmission range of up to 200m. Although these cameras are often easier to install and move around than wired ones.\nVideo Analytics (Management): Video Analytics, also referred to as Video Content Analysis (VCA), is a generic term used to describe computerized processing and analysis of video streams. Computer analysis of video is currently implemented in a variety of fields and industries; however the term “Video Analytics” is typically associated with analysis of video streams captured by surveillance systems. Video Analytics applications can perform a variety of tasks ranging from real-time analysis of video for immediate detection of events of interest, to analysis of pre-recorded video for the purpose of extracting events and data from the recorded video (also known as forensic analysis).", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "680 tvl", "forensic analysis", "realtime analysis", "recorded video", "extracting events", "nvr software", "high resolution", "prerecorded video", "usable video", "internet video", "tasks ranging", "power source", "adds cost", "5 mega pixels", "fifo basis", "proper configuration", "accessed remotely", "network device", "modern dvrs", "successfully working", "convert analog", "ip video", "80211 ip network", "ip network", "generic term", "hard drives", "digital stream", "ip video systems", "hard drives typically", "term video analytics", "analog system video", "digital video footage", "ip stream straight", "video streams captured", "video cables running", "rolling video archive", "latest digital technology", "analog format live", "describe computerized processing", "improved transmission range", "saturated regulated frequencies", "coax cabling back", "todays business environments" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 17, "imageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:27:09.812Z", "updatedon": "2025-05-07T13:27:31.933Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/surveillance-system/17", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": "", "category": "Security Systems", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5f864d3fb9d238d49dab", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Security Systems", "description": "Security Systems: A security alarm is a system designed to detect intrusion – unauthorized entry – into a building or area. Security alarms are used in residential, commercial, industrial, and military properties for protection against burglary (theft) or property damage, as well as personal protection against intruders.\n\nSome alarm systems serve a single purpose of burglary protection; combination systems provide both fire and intrusion protection. Intrusion alarm systems may also be combined with closed-circuit television surveillance systems to automatically record the activities of intruders, and may interface to access control systems for electrically locked doors. Systems range from small, self-contained noisemakers, to complicated, multi-area systems with computer monitoring and control.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "personal protection", "computer monitoring", "automatically record", "single purpose", "property damage", "burglary theft", "military properties", "system designed", "security alarm", "access control systems", "alarm systems serve", "area security alarms", "security systemssecurity systems", "complicated multiarea systems", "small selfcontained noisemakers", "residential commercial industrial" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 16, "imageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:26:30.58Z", "updatedon": "2025-05-07T13:26:30.58Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/security-systems/16", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Security Systems", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }