Home> Products> fire event

{ "products": [ { "_id": "681b6329f619d1f5f02ff854", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "AMC ", "description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "call ready", "service calls", "protected property", "property housed", "night technicians", "technicians aim", "dispatch call", "breakdown call", "addition safelincs", "supervisory signals", "longer meets", "existing space", "issues recommendations", "operations explanation", "older equipment", "alarm dealer", "sprinkler malfunction", "business owners", "quick response", "past inspection", "instant access", "properly repair", "routine inspection", "testing inspecting", "valuable assets", "companies protect", "successful companies", "testing today", "current crisis", "matter day", "manufacturers equipment", "organizations large", "huge range", "save lives", "stateoftheart systems", "fireprotection systems", "detection systems", "system improvement", "signals received", "emergency response", "emergency time", "fire restoring", "fire suppression", "refresher training", "protected facility", "national team", "provide peace", "fire systems", "provide training", "safelincs training safelincs", "fire protection systems", "fire alarms safelincs", "regular maintenance services", "clients facility team", "system application sequence", "system components understanding", "system discharges protecting", "system problem presents", "world trust safelincs", "trouble signals records", "undertake emergency repairs", "local fire department", "required training topics", "provide unmatched performance", "provide online support", "tested regularly inspected", "avoid future problems", "mission critical processes" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 24, "imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:42:01.786Z", "updatedon": "2025-05-07T13:42:01.787Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/amc-/24", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Services & Maintenances", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5eb7e558303897fc397c", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Sensors ", "description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "early detection", "fire increases", "flame phenomena", "optical equipment", "detecting flames", "dangerous gas", "alert people", "audible alarm", "detect fires", "detect smoke", "industrial premises", "air moving", "combined signal", "optical smoke", "operation rateofrise", "main classifications", "rate flow", "element regulate", "smoke alarm", "heat detectors", "projected beam", "areas unaffected", "thermal mass", "smoke detector", "heat detector", "fire beam detector", "sensors smoke detector", "separate heat signal", "heat sensitive element", "thermistor temperature sensors", "detects smoke typically", "large areas typically", "convicted thermal energy", "cost effective means", "ventilation hvac ducts" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 12, "imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:23:03.791Z", "updatedon": "2025-05-07T13:23:03.792Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/sensors-/12", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5e3072012f94c5cd0c07", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Addressable / Intelligent FAS", "description": "An intelligent fire alarm system is designed to provide more efficient detection and prevention. Each intelligent device (smoke detector, heat detector, manual pull station, etc.) has its own unique “address.” If an intelligent device is transferred to an “alarm” state, it activates the fire horns and strobes. When the local fire department arrives, the control panel displays the specific device and area in which the activation occurred. (A conventional zone panel only identifies the general area of an activated device.)", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "general area", "activated device", "activation occurred", "specific device", "fire horns", "alarm state", "intelligent device", "unique address", "efficient detection", "conventional zone panel", "control panel displays" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 10, "imageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:20:48.95Z", "updatedon": "2025-05-07T13:20:48.951Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//addressable-intelligent-fas/10", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5cf1bc744980d54e15b9", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Deluge System", "description": "A deluge system is similar to a pre-action system except the sprinkler heads are open and the pipe is not pressurized with air. Deluge systems are connected to a water supply through a deluge valve that is opened by the operation of a smoke or heat detection system. The detection system is installed in the same area as the sprinklers. When the detection system is activated water discharges through all of the sprinkler heads in the system. Deluge systems are used in places that are considered high hazard areas such as power plants, aircraft hangars and chemical storage or processing facilities. Deluge systems are needed where high velocity suppression is necessary to prevent fire spread.\n\nDeluge Fire Sprinkler Systems differ from conventional Fire Sprinkler Systems in the sense that all sprinkles or nozzles employed in the system are open and when water is released into the system it flows from all discharge devices. As such, this special type of system is generally found within industrial type hazards that require the application of water over a large hazard or area. The control of water is accomplished by the use of a Deluge Valve which is a device that prevents water from entering the system piping until required. A detection system which may incorporate the use of heat, smoke, or flame detectors is used to open the Deluge Valve when a fire or its products of combustion are detected. All system piping is filled with water which discharges from the open sprinklers and nozzles used in the system. In addition to the application of water some deluge systems will incorporate the use of a foam concentrate to mix with water and form a foam solution which can then provide a protective blanket of foam to help control the development of a fire.\nDeluge Fire Sprinkler systems protect extra hazard occupancies that require significant amounts of water to cool and control the growth or development of a fire. Typically they are employed on hazards that contain low flash point flammable liquids or hazards with large amounts of combustible liquids. These types of hazards may include, oil extraction processes, transformers, tank or vessel protection, distillation processes. Water or Foam Deluge systems are used in the protection of large Aircraft Hangers as one primary means of fire protection.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "open sprinklers", "nozzles employed", "fire protection", "prevents water", "water supply", "fire typically", "system piping", "preaction system", "primary means", "combustible liquids", "protective blanket", "foam solution", "foam concentrate", "flame detectors", "heat smoke", "generally found", "discharge devices", "chemical storage", "sprinkler heads", "detection system", "large hazard", "deluge valve", "special type", "large amounts", "deluge systems", "activated water discharges", "heat detection system", "industrial type hazards", "system deluge systems", "foam deluge systems", "require significant amounts", "air deluge systems", "large aircraft hangers", "high velocity suppression" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 6, "imageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:15:29.727Z", "updatedon": "2025-05-07T13:15:29.728Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/deluge-system/6", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5c35944888e973c896fa", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Pre-action System", "description": "Pre-action fire sprinkler systems employ the basic concept of a dry pipe system in that water is not normally contained within the pipes. The difference, however, is that water is held from piping by an electrically operated valve, known as a pre-action valve. Valve operation is controlled by independent flame, heat, or smoke detection.\n\nTwo separate events must happen to initiate sprinkler discharge. First, the detection system must identify a developing fire and then open the pre-action valve. This allows water to flow into system piping, which effectively creates a wet pipe sprinkler system. Second, individual sprinkler heads must release to permit water flow onto the fire.\n\nIn some instances, the pre-action system may be set up with a double interlock in which pressurized air or nitrogen is added to system piping. The purpose of this feature is two-fold: first to monitor piping for leaks and second to hold water from system piping in the event of inadvertent detector operation. The most common application for this system type is in freezer warehouses.\n\nAdvantages of using pre-action fire sprinkler systems include:\n\nThe dual action required for water release – The pre-action valve must operate and sprinkler heads must fuse. This feature provides an added level of protection against inadvertent discharge. For this reason, pre-action systems are frequently employed in water sensitive environments such as archival vaults, fine art storage rooms, rare book libraries and computer centers.\nDisadvantages of using pre-action fire sprinkler systems include:\n\nHigher installation and maintenance costs – Pre-action systems are more complex with several additional components, notably a fire detection system. This adds to the overall system cost.\nModification difficulties – As with dry-pipe systems, pre-action sprinkler systems have specific size limitations which may impact future system modifications. In addition, system modifications must incorporate changes to the fire detection and control system to ensure proper operation.\nPotential decreased reliability – The higher level of complexity associated with pre-action systems creates an increased chance that something may not work when needed. Regular maintenance is essential to ensure reliability", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "water release", "added level", "monitor piping", "hold water", "ensure reliability", "increased chance", "higher level", "higher installation", "frequently employed", "common application", "pressurized air", "double interlock", "developing fire", "separate events", "basic concept", "system piping", "fire detection", "smoke detection", "control system", "system type", "effectively creates", "detection system", "preaction system", "preaction valve", "inadvertent discharge", "sprinkler heads", "fire detection system", "permit water flow", "water sensitive environments", "preaction systems creates", "individual sprinkler heads", "initiate sprinkler discharge", "addition system modifications", "dry pipe system", "electrically operated valve", "reason preaction systems", "inadvertent detector operation", "needed regular maintenance", "specific size limitations", "additional components notably", "computer centers disadvantages", "dual action required", "freezer warehouses advantages", "independent flame heat" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 5, "imageuri": "https://bizimages.withfloats.com/actual/a2b28c13a31c434f8b0831ddd429b1d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a2b28c13a31c434f8b0831ddd429b1d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:12:21.517Z", "updatedon": "2025-05-07T13:12:21.518Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/pre-action-system/5", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5bdc4d3fb9d238d49d7e", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Dry Sprinkler System", "description": "A dry pipe sprinkler system is one in which pipes are filled with pressurized air or nitrogen, rather than water. This air holds a remote valve, known as a dry pipe valve, in a closed position. Located in a heated space, the dry-pipe valve prevents water from entering the pipe until a fire causes one or more sprinklers to operate. Once this happens, the air escapes and the dry pipe valve releases. Water then enters the pipe, flowing through open sprinklers onto the fire.\n\nAdvantages of using dry pipe fire sprinkler systems include:\n\nDry pipe sprinkler systems provide automatic protection in spaces where freezing is possible and water sensitive areas. Typical dry pipe installations include unheated warehouses and attics, outside exposed loading docks and within commercial freezers.\nThis perceived benefit is due to a fear that a physically damaged wet pipe system will leak while dry pipe systems will not. In these situations, however, dry pipe systems will generally not offer any advantage over wet pipe systems. Should impact damage happen, there will only be a mild discharge delay, i.e. 1 minute, while air in the piping is released before water flow.\n\nDisadvantages of using dry pipe fire sprinkler systems include:\n\nIncreased complexity – Dry pipe systems require additional control equipment and air pressure supply components which increases system complexity. Without proper maintenance this equipment may be less reliable than a comparable wet pipe system.\nHigher installation and maintenance costs – The added complexity impacts the overall dry-pipe installation cost. This complexity also increases maintenance expenditure, primarily due to added service labor costs.\nLower design flexibility – There are strict requirements regarding the maximum permitted size (typically 750 gallons) of individual dry-pipe systems. These limitations may impact the ability of an owner to make system additions.\nIncreased fire response time – Up to 60 seconds may pass from the time a sprinkler opens until water is discharged onto the fire. This will delay fire extinguishing actions, which may produce increased content damage.\nIncreased corrosion potential – Following operation, dry-pipe sprinkler systems must be completely drained and dried. Otherwise remaining water may cause pipe corrosion and premature failure. This is not a problem with wet pipe systems where water is constantly maintained in piping.\nWith the exception of unheated building spaces and freezer rooms, dry pipe systems do not offer any significant advantages over wet pipe systems.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": null, "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 4, "imageuri": "https://bizimages.withfloats.com/actual/8979708320c54b84abbfec64c2d74dd7.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/8979708320c54b84abbfec64c2d74dd7.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:10:52.668Z", "updatedon": "2025-05-07T13:10:52.669Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/dry-sprinkler-system/4", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6220e66948a919653f34", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire extinguisher", "description": "A Fire extinguisher is a device which can be used to control a fire. Fire extinguishers can help remove the fire, and may stop it from burning. Depending on the size, some fire extinguishers can be carried around and operated by hand. There are different kinds of fire extinguishers. Different kinds of fire can be controlled by different substances Classfication of Fire Extinguishers\n\nClass A fires involve organic solids such as paper and wood.\nClass B fires involve flammable or combustible liquids, including petrol, grease, and oil.\nClass C fires involve flammable gases.\nClass D fires involve combustible metals.\nClass E fires involve electrical equipment/appliances.\nClass F fires involve cooking fat and oil.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "oil class", "petrol grease", "combustible liquids", "substances classfication", "burning depending", "wood class", "fire extinguishers", "fire fire extinguishers", "fire extinguishers class", "fires involve flammable" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 23, "imageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:37:36.166Z", "updatedon": "2025-05-07T13:37:36.166Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//fire-extinguisher/23", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire extinguisher", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6163bd1f50f146548dbb", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Gas Suppression", "description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "90 percent", "625 percent", "discharge nozzle", "hazard area", "agent reaches", "effective means", "modular hardware", "fm200novec 1230 system", "propelling mechanism", "concentration range", "data processing", "computer servers", "requires minimal space" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 21, "imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:34:27.743Z", "updatedon": "2025-05-07T13:34:27.744Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/gas-suppression/21", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60b44d3fb9d238d49de3", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Server Room Protection", "description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "small fire", "critical facilities", "sensitive electronics", "catastrophic loss", "early stages", "detect alert", "obligatory part", "server room", "damaging highvalue equipment", "server room design", "interrupting vital operations", "computercontrolled manufacturing operations" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 20, "imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:31:32.102Z", "updatedon": "2025-05-07T13:31:32.102Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/server-room-protection/20", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }