Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360
android app
/
iOS App/ web portal.
{
"products": [
{
"_id": "681b5d2a701ce9d7e115dced",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Water Spray systems",
"description": "Water spray nozzles are designed to spray water directly onto the hazard surface via a series of nozzles with a carefully predetermined spray pattern. They are suitable for a variety of special hazards including transformer, turbines and combustible liquid hazards and systems can be individually tailored to your needs.\n\nHigh velocity systems – getting under the fire\n\nHigh velocity systems are often used to protect equipment that incorporate heavy or medium oils; equipment such as transformers, circuit breakers, diesel engines and fuel oil storage tanks, turbo alternator lube oil systems and oil fired boilers.\n\nThe high velocity nozzles are specifically designed to discharge a jet of water at high speed. The water jet forms a cone of coarse spray of uniform density which is discharged over a defined area. The coarse spray is able to penetrate the flame zone and reach the surface of the burning oil. The turbulence created by the high velocity spray forms an oil-in-water emulsion on the surface of the oil that will not burn. This “emulsification” is the principal way the fire is extinguished, along with a cooling and smothering effect.\n\nThe shape of the spray cone, the fire area contacted and the water flow is all controlled by the nozzle specifications – the orifice size and the shape of the internal swirl plate – along with the water pressure and the orientation of the nozzle.\n\nMedium velocity systems – cooling fire down\n\nMedium velocity sprayers discharge a water spray of finely divided droplets at medium velocity. They are ideal for protecting hazards involving light oils where emulsification from high velocity sprayers is not possible. The fine spray has a high heat absorption rate so medium velocity sprayers are an effective method of protecting adjacent plant and structures from heat during a fire by providing a continuous cooling spray over the exposed surfaces. Keeping nearby equipment cool minimises damage and reduces the risk of explosion.\n\nMedium velocity sprayers can be used in combination with other fire fighting systems – dry chemical and foam can be used effectively under the discharge. The fine spray also works to dilute and disperse flammable vapours. The sprayers use an external deflector to achieve the desired discharge angle and spray characteristics",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"hazard surface",
"specifically designed",
"spray cone",
"external deflector",
"effective method",
"orifice size",
"nozzle specifications",
"smothering effect",
"oilinwater emulsion",
"turbulence created",
"burning oil",
"flame zone",
"uniform density",
"incorporate heavy",
"individually tailored",
"transformer turbines",
"water pressure",
"water flow",
"spray characteristics",
"fine spray",
"coarse spray",
"water spray",
"defined area",
"protect equipment",
"special hazards",
"high speed",
"medium velocity",
"water jet forms",
"fire area contacted",
"continuous cooling spray",
"spray water directly",
"high velocity nozzles",
"high velocity systems",
"desired discharge angle",
"medium velocity sprayers",
"high velocity sprayers",
"oil fired boilers",
"medium oils equipment",
"combustible liquid hazards",
"disperse flammable vapours",
"protecting adjacent plant",
"finely divided droplets",
"internal swirl plate"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 7,
"imageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:16:26.609Z",
"updatedon": "2025-05-07T13:16:26.609Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/water-spray-systems/7",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Sprinkler System",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6329f619d1f5f02ff854",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "AMC ",
"description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"call ready",
"service calls",
"protected property",
"property housed",
"night technicians",
"technicians aim",
"dispatch call",
"breakdown call",
"addition safelincs",
"supervisory signals",
"longer meets",
"existing space",
"issues recommendations",
"operations explanation",
"older equipment",
"alarm dealer",
"sprinkler malfunction",
"business owners",
"quick response",
"past inspection",
"instant access",
"properly repair",
"routine inspection",
"testing inspecting",
"valuable assets",
"companies protect",
"successful companies",
"testing today",
"current crisis",
"matter day",
"manufacturers equipment",
"organizations large",
"huge range",
"save lives",
"stateoftheart systems",
"fireprotection systems",
"detection systems",
"system improvement",
"signals received",
"emergency response",
"emergency time",
"fire restoring",
"fire suppression",
"refresher training",
"protected facility",
"national team",
"provide peace",
"fire systems",
"provide training",
"safelincs training safelincs",
"fire protection systems",
"fire alarms safelincs",
"regular maintenance services",
"clients facility team",
"system application sequence",
"system components understanding",
"system discharges protecting",
"system problem presents",
"world trust safelincs",
"trouble signals records",
"undertake emergency repairs",
"local fire department",
"required training topics",
"provide unmatched performance",
"provide online support",
"tested regularly inspected",
"avoid future problems",
"mission critical processes"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 24,
"imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:42:01.786Z",
"updatedon": "2025-05-07T13:42:01.787Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/amc-/24",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Services & Maintenances",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b60731670c79d70e49a27",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Intrusion Systems",
"description": "Intruder detection systems are an integral element in your security management system. Security performance enhancements and cost savings can be achieved by combining intrusion alarm systems together with video surveillance and access control. Siemens embraces this shift in mindset and its intruder detection systems that can be integrated and even monitored by one central management station (Surveillance Fusion).\n\nThe Other various elements involved in this are\n\nPIR – Pet Immune passive infrared sensor\nMotion Sensor 360deg\nGlass break sensor",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"elements involved",
"video surveillance",
"cost savings",
"integral element",
"intruder detection systems"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 19,
"imageuri": "https://bizimages.withfloats.com/actual/24e36ff5d81448d9a976ed96f39ca792.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/24e36ff5d81448d9a976ed96f39ca792.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:30:27.635Z",
"updatedon": "2025-05-07T13:30:27.636Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/intrusion-systems/19",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b6014162e7d0c0951856e",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Access Control Systems",
"description": "Access control systems deliver maximum protection, versatility, simple operation and cost efficiency – all while helping to limit; corporate liability, employee theft, workplace violence, and the high cost of re-keying. Growing companies throughout the region are benefiting from the scalable nature of access control solutions.\n\nThe access control system is the central component of any integrated security system for several reasons. The access control software is installed on a server which already has the employee database and which is already connected to the LAN/WAN for communications. The next step is to integrate the intrusion detection system and the digital video system into the access control software and have the systems operate as one logical system.\n\nReader\nMagnetic\nProximity\nIntelligent\nBio-metric\nFace Recognition\nIris Scanner\nTime & attendance\nVisitor Management\nGuard Tour",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"systems operate",
"employee database",
"central component",
"scalable nature",
"high cost",
"cost efficiency",
"digital video system",
"intrusion detection system",
"access control software",
"integrated security system",
"access control system",
"access control solutions",
"rekeying growing companies"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 18,
"imageuri": "https://bizimages.withfloats.com/actual/58e76ad807dd49ccb94194e0d5eca8a2.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/58e76ad807dd49ccb94194e0d5eca8a2.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:28:52.954Z",
"updatedon": "2025-05-07T13:28:52.955Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//access-control-systems/18",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5fadab7a210d40661fb6",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Surveillance System",
"description": "Video surveillance delivers unprecedented abilities to monitor and manage the risks of today’s business environments. These easy to use systems are successfully working to help reduce theft, workplace violence, and fraudulent workman’s compensation claims.\n\nAnalog System : Cameras on an analog CCTV system send their video in the traditional base band format over coax cabling back to a digital video recorder (DVR). Here, video is digitized and stored on hard drives. Most modern DVRs are a network device, and as such can be accessed remotely from the LAN, or with the proper configuration, from across a WAN or the internet. Video is kept on hard drives, typically on a FIFO basis so there is always a rolling video archive of the past X days. So, despite the fact that video is being transmitted from the cameras in an analog format, live and recorded video is still available over the network.\nIP Video System : IP video cameras broadcast their video as a digital stream over an IP network. Like an analog system, video is recorded on hard drives, but since the video is an IP stream straight from the camera, there is more flexibility as to how and where that video is recorded. The DVR is replaced with an NVR (network video recorder), which in some cases is just software since it doesn’t need to convert analog to digital. Video footage can then be stored on new or existing network RAID drives as directed by the NVR software.\n\nAnd the biggest factors driving interest in IP video systems is the high resolution that they can offer. Analog cameras max out on resolution at about 680 TVL which equates to roughly 0.6 mega pixels. High end IP cameras on the other hand, are currently available at resolutions above 5 mega pixels. This high resolution in turn gives users the ability to zoom in on video after the fact, and still have usable video.\n\nAnother benefit to IP video is that it is much more compatible with wireless. Wireless analog systems are available, but they either have to convert to IP anyway and broadcast over the 802.11 IP network (which adds cost for encoders), or they get crammed onto the over saturated regulated frequencies and often encounter interference.\n\nWireless security camera systems: it take away the worry of video cables running around your property all you need is a power source. Using the latest digital technology, some wireless CCTV cameras offer an improved transmission range of up to 200m. Although these cameras are often easier to install and move around than wired ones.\nVideo Analytics (Management): Video Analytics, also referred to as Video Content Analysis (VCA), is a generic term used to describe computerized processing and analysis of video streams. Computer analysis of video is currently implemented in a variety of fields and industries; however the term “Video Analytics” is typically associated with analysis of video streams captured by surveillance systems. Video Analytics applications can perform a variety of tasks ranging from real-time analysis of video for immediate detection of events of interest, to analysis of pre-recorded video for the purpose of extracting events and data from the recorded video (also known as forensic analysis).",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"680 tvl",
"forensic analysis",
"realtime analysis",
"recorded video",
"extracting events",
"nvr software",
"high resolution",
"prerecorded video",
"usable video",
"internet video",
"tasks ranging",
"power source",
"adds cost",
"5 mega pixels",
"fifo basis",
"proper configuration",
"accessed remotely",
"network device",
"modern dvrs",
"successfully working",
"convert analog",
"ip video",
"80211 ip network",
"ip network",
"generic term",
"hard drives",
"digital stream",
"ip video systems",
"hard drives typically",
"term video analytics",
"analog system video",
"digital video footage",
"ip stream straight",
"video streams captured",
"video cables running",
"rolling video archive",
"latest digital technology",
"analog format live",
"describe computerized processing",
"improved transmission range",
"saturated regulated frequencies",
"coax cabling back",
"todays business environments"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 17,
"imageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/a4b1eb76faf04f22a73d0efc0b3ad23b.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:27:09.812Z",
"updatedon": "2025-05-07T13:27:31.933Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/surveillance-system/17",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": "",
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5f864d3fb9d238d49dab",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Security Systems",
"description": "Security Systems: A security alarm is a system designed to detect intrusion – unauthorized entry – into a building or area. Security alarms are used in residential, commercial, industrial, and military properties for protection against burglary (theft) or property damage, as well as personal protection against intruders.\n\nSome alarm systems serve a single purpose of burglary protection; combination systems provide both fire and intrusion protection. Intrusion alarm systems may also be combined with closed-circuit television surveillance systems to automatically record the activities of intruders, and may interface to access control systems for electrically locked doors. Systems range from small, self-contained noisemakers, to complicated, multi-area systems with computer monitoring and control.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"personal protection",
"computer monitoring",
"automatically record",
"single purpose",
"property damage",
"burglary theft",
"military properties",
"system designed",
"security alarm",
"access control systems",
"alarm systems serve",
"area security alarms",
"security systemssecurity systems",
"complicated multiarea systems",
"small selfcontained noisemakers",
"residential commercial industrial"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 16,
"imageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:26:30.58Z",
"updatedon": "2025-05-07T13:26:30.58Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//security-systems/16",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5f295d31b5f2e0d46dad",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Public Address & Voice Alarm Systems",
"description": "Public Address / Talk back System:\n\nA Public Address (PA) system is a collection of audio equipment that allows broadcasts over a designated area. Often found in schools and office buildings, PA systems can be used for general announcements or emergency information, providing a simple way to get information out quickly. PA systems can be basic or advanced, and people can customize them to fit a variety of needs.\n\nBasic PA systems are comprised of loudspeakers placed in convenient locations, an amplifier to increase the sound, and a mixer that adjusts audio levels. The user speaks into a microphone, and the sound is transmitted through connected cables, or a wireless system, out through the speakers. Some systems also include microphones or intercoms near the speaker locations, allowing the listener to reply to the central location. These responses are not broadcast to the entire system, however, but only to the main user area.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"entire system",
"central location",
"wireless system",
"connected cables",
"general announcements",
"user speaks",
"convenient locations",
"designated area",
"audio equipment",
"basic pa systems",
"main user area",
"emergency information providing",
"quickly pa systems",
"speaker locations allowing",
"adjusts audio levels"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 14,
"imageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:24:57.042Z",
"updatedon": "2025-05-07T13:24:57.043Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/public-address-voice-alarm-systems/14",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Evacuation System",
"tags": [],
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5eecc848881bcc16654a",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Evacuation System",
"description": "Fire alarm voice evacuation system uses speakers and amplifiers to notify occupants with an alarm tone followed by a voice instead of the traditional horn or bell. Also provides ability for live voice announcements by the fire department or emergency personnel through a local paging microphone. These voice evacuation systems are most commonly installed in two types of building occupancies:\n\nPlace of Assembly: Where more than 50 people congregate, but may be unfamiliar with exit locations, or fire emergency signals, voice systems can instruct people to remain calm, and to evacuate the building.\nHigh Rise: When it is impractical to evacuate a building in its entirety, zoned evacuation of the occupants is used to conduct an instructed evacuation of floors or areas within the building.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"notify occupants",
"remain calm",
"instruct people",
"exit locations",
"50 people congregate",
"commonly installed",
"emergency personnel",
"fire department",
"traditional horn",
"alarm tone",
"instructed evacuation",
"building high rise",
"building occupancies place",
"voice evacuation systems",
"live voice announcements",
"entirety zoned evacuation",
"local paging microphone"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 13,
"imageuri": "https://bizimages.withfloats.com/actual/153b10c135934fdd982db0b6b22f117f.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/153b10c135934fdd982db0b6b22f117f.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:23:56.721Z",
"updatedon": "2025-05-07T13:23:56.722Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//evacuation-system/13",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Evacuation System",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5e3072012f94c5cd0c07",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Addressable / Intelligent FAS",
"description": "An intelligent fire alarm system is designed to provide more efficient detection and prevention. Each intelligent device (smoke detector, heat detector, manual pull station, etc.) has its own unique “address.” If an intelligent device is transferred to an “alarm” state, it activates the fire horns and strobes. When the local fire department arrives, the control panel displays the specific device and area in which the activation occurred. (A conventional zone panel only identifies the general area of an activated device.)",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"general area",
"activated device",
"activation occurred",
"specific device",
"fire horns",
"alarm state",
"intelligent device",
"unique address",
"efficient detection",
"conventional zone panel",
"control panel displays"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 10,
"imageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:20:48.95Z",
"updatedon": "2025-05-07T13:20:48.951Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//addressable-intelligent-fas/10",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
}
],
"hasmoreitems": false,
"isapirequest": false,
"totalresults": 24,
"query": null,
"floatingpoint": null
}