Home> Products> desired levels

{ "products": [ { "_id": "681b5f295d31b5f2e0d46dad", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Public Address & Voice Alarm Systems", "description": "Public Address / Talk back System:\n\nA Public Address (PA) system is a collection of audio equipment that allows broadcasts over a designated area. Often found in schools and office buildings, PA systems can be used for general announcements or emergency information, providing a simple way to get information out quickly. PA systems can be basic or advanced, and people can customize them to fit a variety of needs.\n\nBasic PA systems are comprised of loudspeakers placed in convenient locations, an amplifier to increase the sound, and a mixer that adjusts audio levels. The user speaks into a microphone, and the sound is transmitted through connected cables, or a wireless system, out through the speakers. Some systems also include microphones or intercoms near the speaker locations, allowing the listener to reply to the central location. These responses are not broadcast to the entire system, however, but only to the main user area.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "entire system", "central location", "wireless system", "connected cables", "general announcements", "user speaks", "convenient locations", "designated area", "audio equipment", "basic pa systems", "main user area", "emergency information providing", "quickly pa systems", "speaker locations allowing", "adjusts audio levels" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 14, "imageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:24:57.042Z", "updatedon": "2025-05-07T13:24:57.043Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/public-address-voice-alarm-systems/14", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Evacuation System", "tags": [], "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5de53a26099a76a38095", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire Detection and Alarm", "description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "building occupants", "alert people", "initiating device", "aircraft hangers", "computer rooms", "whats referred", "harmful levels", "hear sounders", "ambient noise", "vision impaired", "hearing impaired", "pull stations", "detects things", "maintenance area", "generally inside", "communication ports", "modern facps", "turn decides", "decipher messages", "remotely monitored", "notification device", "notification appliance", "firedetection system", "evac system", "system easier", "system troubles", "initiating devices", "fire detection", "notification appliances", "fire alarm", "fire alarm system", "common notification appliances", "notification devices connected", "hospital operating rooms", "fire alarm manually", "preaction suppression system", "prerecorded evacuation plan", "water flow detectors", "electrical room office", "keypads lcd screens" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 9, "imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:19:33.065Z", "updatedon": "2025-05-07T13:19:33.066Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//fire-detection-and-alarm/9", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d2a701ce9d7e115dced", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Water Spray systems", "description": "Water spray nozzles are designed to spray water directly onto the hazard surface via a series of nozzles with a carefully predetermined spray pattern. They are suitable for a variety of special hazards including transformer, turbines and combustible liquid hazards and systems can be individually tailored to your needs.\n\nHigh velocity systems – getting under the fire\n\nHigh velocity systems are often used to protect equipment that incorporate heavy or medium oils; equipment such as transformers, circuit breakers, diesel engines and fuel oil storage tanks, turbo alternator lube oil systems and oil fired boilers.\n\nThe high velocity nozzles are specifically designed to discharge a jet of water at high speed. The water jet forms a cone of coarse spray of uniform density which is discharged over a defined area. The coarse spray is able to penetrate the flame zone and reach the surface of the burning oil. The turbulence created by the high velocity spray forms an oil-in-water emulsion on the surface of the oil that will not burn. This “emulsification” is the principal way the fire is extinguished, along with a cooling and smothering effect.\n\nThe shape of the spray cone, the fire area contacted and the water flow is all controlled by the nozzle specifications – the orifice size and the shape of the internal swirl plate – along with the water pressure and the orientation of the nozzle.\n\nMedium velocity systems – cooling fire down\n\nMedium velocity sprayers discharge a water spray of finely divided droplets at medium velocity. They are ideal for protecting hazards involving light oils where emulsification from high velocity sprayers is not possible. The fine spray has a high heat absorption rate so medium velocity sprayers are an effective method of protecting adjacent plant and structures from heat during a fire by providing a continuous cooling spray over the exposed surfaces. Keeping nearby equipment cool minimises damage and reduces the risk of explosion.\n\nMedium velocity sprayers can be used in combination with other fire fighting systems – dry chemical and foam can be used effectively under the discharge. The fine spray also works to dilute and disperse flammable vapours. The sprayers use an external deflector to achieve the desired discharge angle and spray characteristics", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "hazard surface", "specifically designed", "spray cone", "external deflector", "effective method", "orifice size", "nozzle specifications", "smothering effect", "oilinwater emulsion", "turbulence created", "burning oil", "flame zone", "uniform density", "incorporate heavy", "individually tailored", "transformer turbines", "water pressure", "water flow", "spray characteristics", "fine spray", "coarse spray", "water spray", "defined area", "protect equipment", "special hazards", "high speed", "medium velocity", "water jet forms", "fire area contacted", "continuous cooling spray", "spray water directly", "high velocity nozzles", "high velocity systems", "desired discharge angle", "medium velocity sprayers", "high velocity sprayers", "oil fired boilers", "medium oils equipment", "combustible liquid hazards", "disperse flammable vapours", "protecting adjacent plant", "finely divided droplets", "internal swirl plate" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 7, "imageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:16:26.609Z", "updatedon": "2025-05-07T13:16:26.609Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/water-spray-systems/7", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5a0b4149ed1d2b01fef1", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Wet Sprinkler System", "description": "Wet pipe systems are the most common fire sprinkler system. A wet pipe system is one in which water is constantly maintained within the sprinkler piping. When a sprinkler activates this water is immediately discharged onto the fire.\n\nAdvantages to using a wet pipe fire sprinkler system include:\n\nSystem simplicity and reliability – Wet pipe sprinkler systems have the least number of components and therefore, the lowest number of items to malfunction. This produces unexcelled reliability which is important since sprinklers may be asked to sit in waiting for many years before they are needed. This simplicity aspect also becomes important in facilities where system maintenance may not be performed with the desired frequency.\nRelative low installation and maintenance expense – Due to their overall simplicity, wet pipe sprinklers require the least amount of installation time and capital. Maintenance cost savings are also realized since less service time is generally required compared to other system types. These savings become important when maintenance budgets are shrinking.\nEase of modification – Wet pipe fire sprinkler systems are advantageous since modifications involve shutting down the water supply, draining pipes and making alterations. Following the work, the system is pressure tested and restored. Additional work for detection and special control equipment is avoided which again saves time and expense.\nShort term down time following a fire – Wet pipe sprinkler systems require the least amount of effort to restore. In most instances, sprinkler protection is reinstated by replacing the fused sprinklers and turning the water supply back on. Pre-action and dry-pipe systems may require additional effort to reset control equipment.\nDisadvantages to using a wet pipe fire sprinkler system include:\n\nWet pipe systems are not suited for sub-freezing environments.\n\nThere may also be a concern where piping is subject to severe impact damage and could consequently leak.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "fused sprinklers", "lowest number", "saves time", "service time", "installation time", "sprinkler piping", "subfreezing environments", "pressure tested", "making alterations", "shrinking ease", "system types", "simplicity aspect", "system simplicity", "fire advantages", "immediately discharged", "constantly maintained", "maintenance budgets", "system maintenance", "sprinkler activates", "drypipe systems", "water supply back", "require additional effort", "restored additional work", "wet pipe system", "instances sprinkler protection", "maintenance expense due", "wet pipe systems", "severe impact damage", "expense short term", "special control equipment", "modifications involve shutting", "generally required compared", "produces unexcelled reliability" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 3, "imageuri": "https://bizimages.withfloats.com/actual/53b1e1444fa84a9eaf0eeb3ee4b3e81d.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/53b1e1444fa84a9eaf0eeb3ee4b3e81d.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:03:07.499Z", "updatedon": "2025-05-07T13:03:07.5Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//wet-sprinkler-system/3", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6329f619d1f5f02ff854", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "AMC ", "description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "call ready", "service calls", "protected property", "property housed", "night technicians", "technicians aim", "dispatch call", "breakdown call", "addition safelincs", "supervisory signals", "longer meets", "existing space", "issues recommendations", "operations explanation", "older equipment", "alarm dealer", "sprinkler malfunction", "business owners", "quick response", "past inspection", "instant access", "properly repair", "routine inspection", "testing inspecting", "valuable assets", "companies protect", "successful companies", "testing today", "current crisis", "matter day", "manufacturers equipment", "organizations large", "huge range", "save lives", "stateoftheart systems", "fireprotection systems", "detection systems", "system improvement", "signals received", "emergency response", "emergency time", "fire restoring", "fire suppression", "refresher training", "protected facility", "national team", "provide peace", "fire systems", "provide training", "safelincs training safelincs", "fire protection systems", "fire alarms safelincs", "regular maintenance services", "clients facility team", "system application sequence", "system components understanding", "system discharges protecting", "system problem presents", "world trust safelincs", "trouble signals records", "undertake emergency repairs", "local fire department", "required training topics", "provide unmatched performance", "provide online support", "tested regularly inspected", "avoid future problems", "mission critical processes" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 24, "imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:42:01.786Z", "updatedon": "2025-05-07T13:42:01.787Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/amc-/24", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Services & Maintenances", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6220e66948a919653f34", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire extinguisher", "description": "A Fire extinguisher is a device which can be used to control a fire. Fire extinguishers can help remove the fire, and may stop it from burning. Depending on the size, some fire extinguishers can be carried around and operated by hand. There are different kinds of fire extinguishers. Different kinds of fire can be controlled by different substances Classfication of Fire Extinguishers\n\nClass A fires involve organic solids such as paper and wood.\nClass B fires involve flammable or combustible liquids, including petrol, grease, and oil.\nClass C fires involve flammable gases.\nClass D fires involve combustible metals.\nClass E fires involve electrical equipment/appliances.\nClass F fires involve cooking fat and oil.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "oil class", "petrol grease", "combustible liquids", "substances classfication", "burning depending", "wood class", "fire extinguishers", "fire fire extinguishers", "fire extinguishers class", "fires involve flammable" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 23, "imageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/fb5de381b839453c898a577d35783fcf.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:37:36.166Z", "updatedon": "2025-05-07T13:37:36.166Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//fire-extinguisher/23", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire extinguisher", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b61def36ed9034d8fc8e6", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Water Leak Detection", "description": "Water leaks can cause great damage to your property especially when it comes to electronics. A water detection sensor detects the presence of water before it contacts electronics or other valuables in the room. Use a leak detection sensor having a water sensor alarm to protect your property. When the leak detection equipment senses a leakage, the property manager is notified immediately so that action to remedy the cause can be taken as soon as possible.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "property manager", "contacts electronics", "notified immediately", "great damage", "water sensor alarm", "leak detection sensor" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 22, "imageuri": "https://bizimages.withfloats.com/actual/64ab299783ef4ba59557095991ef881d.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/64ab299783ef4ba59557095991ef881d.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:36:30.703Z", "updatedon": "2025-05-07T13:36:30.703Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//water-leak-detection/22", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b6163bd1f50f146548dbb", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Gas Suppression", "description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "90 percent", "625 percent", "discharge nozzle", "hazard area", "agent reaches", "effective means", "modular hardware", "fm200novec 1230 system", "propelling mechanism", "concentration range", "data processing", "computer servers", "requires minimal space" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 21, "imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:34:27.743Z", "updatedon": "2025-05-07T13:34:27.744Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/gas-suppression/21", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b60b44d3fb9d238d49de3", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Server Room Protection", "description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "small fire", "critical facilities", "sensitive electronics", "catastrophic loss", "early stages", "detect alert", "obligatory part", "server room", "damaging highvalue equipment", "server room design", "interrupting vital operations", "computercontrolled manufacturing operations" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 20, "imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:31:32.102Z", "updatedon": "2025-05-07T13:31:32.102Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/server-room-protection/20", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }