Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360
android app
/
iOS App/ web portal.
{
"products": [
{
"_id": "681b60b44d3fb9d238d49de3",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Server Room Protection",
"description": "Fire protection is a critical and obligatory part of server room design and planning. Because a fire can happen at any time, IT must be prepared to protect the server room with the necessary equipment. The fire protection system’s main goal should be to detect, alert and suppress the fire in the early stages. A small fire in critical facilities such as data processing centers, telecom switching rooms, airport control towers, clean rooms, laboratories and computer-controlled manufacturing operations can result in catastrophic loss by interrupting vital operations and damaging high-value equipment.\n\nIn these situations, it’s important that fires be knocked down quickly – before they have a chance to spread – and that sensitive electronics and other equipment not be damaged in the process of putting out the fire.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"small fire",
"critical facilities",
"sensitive electronics",
"catastrophic loss",
"early stages",
"detect alert",
"obligatory part",
"server room",
"damaging highvalue equipment",
"server room design",
"interrupting vital operations",
"computercontrolled manufacturing operations"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 20,
"imageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/a387ca5557114172ba2d7358b5964c31.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:31:32.102Z",
"updatedon": "2025-05-07T13:31:32.102Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/server-room-protection/20",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Server Room Protection",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5f864d3fb9d238d49dab",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Security Systems",
"description": "Security Systems: A security alarm is a system designed to detect intrusion – unauthorized entry – into a building or area. Security alarms are used in residential, commercial, industrial, and military properties for protection against burglary (theft) or property damage, as well as personal protection against intruders.\n\nSome alarm systems serve a single purpose of burglary protection; combination systems provide both fire and intrusion protection. Intrusion alarm systems may also be combined with closed-circuit television surveillance systems to automatically record the activities of intruders, and may interface to access control systems for electrically locked doors. Systems range from small, self-contained noisemakers, to complicated, multi-area systems with computer monitoring and control.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"personal protection",
"computer monitoring",
"automatically record",
"single purpose",
"property damage",
"burglary theft",
"military properties",
"system designed",
"security alarm",
"access control systems",
"alarm systems serve",
"area security alarms",
"security systemssecurity systems",
"complicated multiarea systems",
"small selfcontained noisemakers",
"residential commercial industrial"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 16,
"imageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:26:30.58Z",
"updatedon": "2025-05-07T13:26:30.58Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/security-systems/16",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Security Systems",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5f295d31b5f2e0d46dad",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Public Address & Voice Alarm Systems",
"description": "Public Address / Talk back System:\n\nA Public Address (PA) system is a collection of audio equipment that allows broadcasts over a designated area. Often found in schools and office buildings, PA systems can be used for general announcements or emergency information, providing a simple way to get information out quickly. PA systems can be basic or advanced, and people can customize them to fit a variety of needs.\n\nBasic PA systems are comprised of loudspeakers placed in convenient locations, an amplifier to increase the sound, and a mixer that adjusts audio levels. The user speaks into a microphone, and the sound is transmitted through connected cables, or a wireless system, out through the speakers. Some systems also include microphones or intercoms near the speaker locations, allowing the listener to reply to the central location. These responses are not broadcast to the entire system, however, but only to the main user area.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"entire system",
"central location",
"wireless system",
"connected cables",
"general announcements",
"user speaks",
"convenient locations",
"designated area",
"audio equipment",
"basic pa systems",
"main user area",
"emergency information providing",
"quickly pa systems",
"speaker locations allowing",
"adjusts audio levels"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 14,
"imageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:24:57.042Z",
"updatedon": "2025-05-07T13:24:57.043Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/public-address-voice-alarm-systems/14",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Evacuation System",
"tags": [],
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5eb7e558303897fc397c",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Sensors ",
"description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"early detection",
"fire increases",
"flame phenomena",
"optical equipment",
"detecting flames",
"dangerous gas",
"alert people",
"audible alarm",
"detect fires",
"detect smoke",
"industrial premises",
"air moving",
"combined signal",
"optical smoke",
"operation rateofrise",
"main classifications",
"rate flow",
"element regulate",
"smoke alarm",
"heat detectors",
"projected beam",
"areas unaffected",
"thermal mass",
"smoke detector",
"heat detector",
"fire beam detector",
"sensors smoke detector",
"separate heat signal",
"heat sensitive element",
"thermistor temperature sensors",
"detects smoke typically",
"large areas typically",
"convicted thermal energy",
"cost effective means",
"ventilation hvac ducts"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 12,
"imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:23:03.791Z",
"updatedon": "2025-05-07T13:23:03.792Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/sensors-/12",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5e3072012f94c5cd0c07",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Addressable / Intelligent FAS",
"description": "An intelligent fire alarm system is designed to provide more efficient detection and prevention. Each intelligent device (smoke detector, heat detector, manual pull station, etc.) has its own unique “address.” If an intelligent device is transferred to an “alarm” state, it activates the fire horns and strobes. When the local fire department arrives, the control panel displays the specific device and area in which the activation occurred. (A conventional zone panel only identifies the general area of an activated device.)",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"general area",
"activated device",
"activation occurred",
"specific device",
"fire horns",
"alarm state",
"intelligent device",
"unique address",
"efficient detection",
"conventional zone panel",
"control panel displays"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 10,
"imageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/40675ce2ee724cae8dd9221c373a0da4.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:20:48.95Z",
"updatedon": "2025-05-07T13:20:48.951Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE//addressable-intelligent-fas/10",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Detection and Alarm",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5d2a701ce9d7e115dced",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Water Spray systems",
"description": "Water spray nozzles are designed to spray water directly onto the hazard surface via a series of nozzles with a carefully predetermined spray pattern. They are suitable for a variety of special hazards including transformer, turbines and combustible liquid hazards and systems can be individually tailored to your needs.\n\nHigh velocity systems – getting under the fire\n\nHigh velocity systems are often used to protect equipment that incorporate heavy or medium oils; equipment such as transformers, circuit breakers, diesel engines and fuel oil storage tanks, turbo alternator lube oil systems and oil fired boilers.\n\nThe high velocity nozzles are specifically designed to discharge a jet of water at high speed. The water jet forms a cone of coarse spray of uniform density which is discharged over a defined area. The coarse spray is able to penetrate the flame zone and reach the surface of the burning oil. The turbulence created by the high velocity spray forms an oil-in-water emulsion on the surface of the oil that will not burn. This “emulsification” is the principal way the fire is extinguished, along with a cooling and smothering effect.\n\nThe shape of the spray cone, the fire area contacted and the water flow is all controlled by the nozzle specifications – the orifice size and the shape of the internal swirl plate – along with the water pressure and the orientation of the nozzle.\n\nMedium velocity systems – cooling fire down\n\nMedium velocity sprayers discharge a water spray of finely divided droplets at medium velocity. They are ideal for protecting hazards involving light oils where emulsification from high velocity sprayers is not possible. The fine spray has a high heat absorption rate so medium velocity sprayers are an effective method of protecting adjacent plant and structures from heat during a fire by providing a continuous cooling spray over the exposed surfaces. Keeping nearby equipment cool minimises damage and reduces the risk of explosion.\n\nMedium velocity sprayers can be used in combination with other fire fighting systems – dry chemical and foam can be used effectively under the discharge. The fine spray also works to dilute and disperse flammable vapours. The sprayers use an external deflector to achieve the desired discharge angle and spray characteristics",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"hazard surface",
"specifically designed",
"spray cone",
"external deflector",
"effective method",
"orifice size",
"nozzle specifications",
"smothering effect",
"oilinwater emulsion",
"turbulence created",
"burning oil",
"flame zone",
"uniform density",
"incorporate heavy",
"individually tailored",
"transformer turbines",
"water pressure",
"water flow",
"spray characteristics",
"fine spray",
"coarse spray",
"water spray",
"defined area",
"protect equipment",
"special hazards",
"high speed",
"medium velocity",
"water jet forms",
"fire area contacted",
"continuous cooling spray",
"spray water directly",
"high velocity nozzles",
"high velocity systems",
"desired discharge angle",
"medium velocity sprayers",
"high velocity sprayers",
"oil fired boilers",
"medium oils equipment",
"combustible liquid hazards",
"disperse flammable vapours",
"protecting adjacent plant",
"finely divided droplets",
"internal swirl plate"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 7,
"imageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:16:26.609Z",
"updatedon": "2025-05-07T13:16:26.609Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/water-spray-systems/7",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Sprinkler System",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "681b5bdc4d3fb9d238d49d7e",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Dry Sprinkler System",
"description": "A dry pipe sprinkler system is one in which pipes are filled with pressurized air or nitrogen, rather than water. This air holds a remote valve, known as a dry pipe valve, in a closed position. Located in a heated space, the dry-pipe valve prevents water from entering the pipe until a fire causes one or more sprinklers to operate. Once this happens, the air escapes and the dry pipe valve releases. Water then enters the pipe, flowing through open sprinklers onto the fire.\n\nAdvantages of using dry pipe fire sprinkler systems include:\n\nDry pipe sprinkler systems provide automatic protection in spaces where freezing is possible and water sensitive areas. Typical dry pipe installations include unheated warehouses and attics, outside exposed loading docks and within commercial freezers.\nThis perceived benefit is due to a fear that a physically damaged wet pipe system will leak while dry pipe systems will not. In these situations, however, dry pipe systems will generally not offer any advantage over wet pipe systems. Should impact damage happen, there will only be a mild discharge delay, i.e. 1 minute, while air in the piping is released before water flow.\n\nDisadvantages of using dry pipe fire sprinkler systems include:\n\nIncreased complexity – Dry pipe systems require additional control equipment and air pressure supply components which increases system complexity. Without proper maintenance this equipment may be less reliable than a comparable wet pipe system.\nHigher installation and maintenance costs – The added complexity impacts the overall dry-pipe installation cost. This complexity also increases maintenance expenditure, primarily due to added service labor costs.\nLower design flexibility – There are strict requirements regarding the maximum permitted size (typically 750 gallons) of individual dry-pipe systems. These limitations may impact the ability of an owner to make system additions.\nIncreased fire response time – Up to 60 seconds may pass from the time a sprinkler opens until water is discharged onto the fire. This will delay fire extinguishing actions, which may produce increased content damage.\nIncreased corrosion potential – Following operation, dry-pipe sprinkler systems must be completely drained and dried. Otherwise remaining water may cause pipe corrosion and premature failure. This is not a problem with wet pipe systems where water is constantly maintained in piping.\nWith the exception of unheated building spaces and freezer rooms, dry pipe systems do not offer any significant advantages over wet pipe systems.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": null,
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 4,
"imageuri": "https://bizimages.withfloats.com/actual/8979708320c54b84abbfec64c2d74dd7.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/8979708320c54b84abbfec64c2d74dd7.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:10:52.668Z",
"updatedon": "2025-05-07T13:10:52.669Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/dry-sprinkler-system/4",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Sprinkler System",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
},
{
"_id": "6819bc6c62672667a6b3777d",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "Fire Hydrant System",
"description": "It is most important that the project delivery team include a Fire Protection consultant with adequate experience and knowledge in fire protection and life safety design. The Fire Protection consultant should be involved in all phases of design, execution and planning to occupancy which we provide.\n\nDesign Standards and Criteria (i.e., Building Code, etc.)—is utilized by our Consulting team, including statutory requirements, voluntary requirements addressing owner’s performance needs, and requirements that are sometimes imposed by insurance carriers on commercial projects.",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"commercial projects",
"insurance carriers",
"adequate experience",
"consulting team",
"design execution",
"fire protection",
"fire protection consultant",
"project delivery team",
"provide design standards",
"life safety design",
"fire hydrant systemit"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 1,
"imageuri": "https://bizimages.withfloats.com/actual/0acaf6934b4e4e2fa53a793219ec5024.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/0acaf6934b4e4e2fa53a793219ec5024.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-06T07:38:20.011Z",
"updatedon": "2025-05-06T07:38:20.012Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/fire-hydrant-system/1",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Fire Fighting Systems",
"tags": [],
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 18.0,
"isnotforsale": false
},
{
"_id": "681b6329f619d1f5f02ff854",
"fptag": "SAFENGINEERINGLINCSSYSTEMPVTLT24B9",
"merchantname": null,
"customwidgets": null,
"externalsourceid": null,
"name": "AMC ",
"description": "Well-maintained fire systems help save lives and property\n\nAs the risk of fire is always there, your fire suppression and detection systems need to be ready to perform when you need them most.\n\nThrough our regular maintenance services, our technicians aim to provide properly functioning fire equipment and systems. We service a huge range of fire protection systems for organizations large and small and can also maintain other manufacturers’ equipment.\n\nwe are ready to undertake emergency repairs and service calls to your fire-protection systems and products. Our teams can provide online support to the client’s facility team for all their service and breakdown call during emergency cases.\nSAFELINCS understands that when you have an emergency, time does not matter. Day or Night Technicians are on call, ready to be dispatched to handle your current crisis, with trained, experienced technicians.\n\nInspection and Testing\n\nToday, some of the largest and most successful companies in the world trust SAFELINCS to service and maintain their fire systems. Those same companies protect their most valuable assets and mission critical processes. In fact, over the past years, SAFELINCS’s service team has and continues to provide unmatched performance when it comes to Testing, Inspecting and Maintenance of your fire systems.\n\nFire Alarm and Detection System\nFire Suppression Systems\nHydrant System\nFire Pump Room Equipment\nFire Extinguishers\nSprinkler Systems\nEmergency/Exit Lights\nAccess Systems\nSurveillance Systems\nPublic Address Systems\nVESDA System\nRepair\n\nWhether a failure is uncovered during any routine inspection, or a system problem presents itself, SAFELINCS is committed to respond in a timely manner. SAFELINCS’s field technicians are trained to properly repair and maintenance your system to avoid future problems and future expenses.\n\nStrategically located field technicians for emergency response.\nOur Technicians have instant access to past inspection and maintenance history.\nSystem Recharge\n\nWhen your system discharges, protecting you from a fire, restoring your system is of the highest priority. SAFELINCS stands ready for a quick response and restoration of your suppression system.\n\nSystem Monitoring\n\nSAFELINCS offers fire alarm monitoring services to provide peace of mind to business owners who want a national team of monitors looking after life and property housed within the protected facility. In addition to fire alarms, SAFELINCS provides monitoring of supervisory signals for sprinkler malfunction and trouble signals indicating electrical malfunction. Alarm signals immediately prompt a dispatch call to the local fire department while personnel from the protected property and the alarm dealer are notified of supervisory and trouble signals. Records are maintained of all signals received and the state-of-the-art systems are tested regularly, inspected and maintained by SAFELINCS.\n\nTraining\n\nSAFELINCS provides site & system specific training for new installations. In addition, SAFELINCS has the expertise to provide training for older equipment still in service. In the event that new personnel or refresher training is required.\n\nTraining Topics may include:\n\nOverview of system components.\nUnderstanding of system application.\nSequence of operations.\nExplanation and differentiation of warning or alarm indicators.\nResetting and/or aborting functions.\nRoutine trouble shooting techniques.\nHow to call for service.\nSystem maintenance requirements.\nSafety considerations and issues.\nRecommendations for system improvement, if necessary\nModification\n\nWhen your existing space no longer meets your needs, SAFELINCS can modify your fire protection systems to meet you new requirements",
"price": 0.0,
"discountamount": 0.0,
"currencycode": "INR",
"priority": 1000000,
"isfreeshipmentavailable": false,
"shipmentduration": 0,
"_keywords": [
"call ready",
"service calls",
"protected property",
"property housed",
"night technicians",
"technicians aim",
"dispatch call",
"breakdown call",
"addition safelincs",
"supervisory signals",
"longer meets",
"existing space",
"issues recommendations",
"operations explanation",
"older equipment",
"alarm dealer",
"sprinkler malfunction",
"business owners",
"quick response",
"past inspection",
"instant access",
"properly repair",
"routine inspection",
"testing inspecting",
"valuable assets",
"companies protect",
"successful companies",
"testing today",
"current crisis",
"matter day",
"manufacturers equipment",
"organizations large",
"huge range",
"save lives",
"stateoftheart systems",
"fireprotection systems",
"detection systems",
"system improvement",
"signals received",
"emergency response",
"emergency time",
"fire restoring",
"fire suppression",
"refresher training",
"protected facility",
"national team",
"provide peace",
"fire systems",
"provide training",
"safelincs training safelincs",
"fire protection systems",
"fire alarms safelincs",
"regular maintenance services",
"clients facility team",
"system application sequence",
"system components understanding",
"system discharges protecting",
"system problem presents",
"world trust safelincs",
"trouble signals records",
"undertake emergency repairs",
"local fire department",
"required training topics",
"provide unmatched performance",
"provide online support",
"tested regularly inspected",
"avoid future problems",
"mission critical processes"
],
"isarchived": false,
"isavailable": true,
"applicationid": null,
"productindex": 24,
"imageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"tileimageuri": "https://bizimages.withfloats.com/actual/d9697647bc7d401eb09efcc937a8d58c.jpg",
"images": null,
"totalqueries": 0,
"gpid": null,
"groupproductid": null,
"createdon": "2025-05-07T13:42:01.786Z",
"updatedon": "2025-05-07T13:42:01.787Z",
"buyonlinelink": null,
"producturl": "https://WWW.SAFELINCSINDIA.IN/MYSORE/products/amc-/24",
"availableunits": -1.0,
"iscodavailable": false,
"isprepaidonlineavailable": true,
"maxcodorders": 0,
"maxprepaidonlineorders": 0,
"uniquepaymenturl": null,
"brandname": null,
"category": "Services & Maintenances",
"tags": null,
"variants": false,
"keyspecification": null,
"otherspecifications": null,
"pickupaddressreferenceid": null,
"paymenttype": "AssuredPurchase",
"producttype": "products",
"hsncode": "",
"gstslab": 0.001,
"isnotforsale": false
}
],
"hasmoreitems": false,
"isapirequest": false,
"totalresults": 24,
"query": null,
"floatingpoint": null
}