Preview

This is your website preview.

Currently it only shows your basic business info. Start adding relevant business details such as description, images and products or services to gain your customers attention by using Boost 360 android app / iOS App / web portal.

SAFENGINEERINGLINCSSYSTEMPVTLT3424 6809e95570178180e3d69e6d Products https://www.safelincsindia.in

Novec Gas Suppression Systems

  • 2025-10-03T10:16:46

A Novec fire suppression system uses 3M™ Novec™ 1230 fluid, a clean agent designed for use in sensitive environments like data centers, museums, and telecommunications centers. It is an environmentally friendly, waterless, and residue-free solution that suppresses fires quickly without harming people or damaging valuable electronics and documents. Novec 1230 Fire Suppression System, Novec 1230 Fire ... NOVEC 1230 Fire Safety System Novec 1230 Fire Suppression System Gas Fire System - Gas ... 3M™ Novec™ 1230 fire systems, 3M™ Novec™ 1230 fire suppression How it works Heat absorption: The primary extinguishing mechanism of Novec 1230 fluid is removing heat from the fire. Fire needs three elements to burn: heat, oxygen, and fuel. By rapidly absorbing heat, the system extinguishes the fire in seconds. Total flooding system: In a typical setup, the fluid is stored as a liquid in cylinders pressurized with nitrogen. When detectors sense a fire, the system automatically releases the Novec 1230 fluid into the protected space as a gas. Rapid vaporization: The fluid has a low heat of vaporization and evaporates more than 50 times faster than water. This allows it to rapidly fill the enclosed space and distribute evenly to suppress the fire. Localized suppression: Some systems use heat-sensitive tubing that ruptures at the point of the fire, releasing the agent directly onto the flames for instant suppression. Key features and benefits Environmentally safe: As a replacement for ozone-depleting Halon and some hydrofluorocarbons (HFCs), Novec 1230 fluid has a very low Global Warming Potential (GWP) of less than one and an atmospheric lifetime of only five days. People safe: It has a high safety margin for human occupancy, providing a safe environment for people in the area at the time of discharge. Equipment safe: The agent is electrically non-conductive and non-corrosive, making it safe for protecting sensitive electrical equipment, electronics, and valuable items. Leaves no residue: Since the fluid is waterless and evaporates completely, it leaves no residue that would require extensive cleanup, minimizing business downtime. Effective on multiple fire classes: Novec 1230 systems are suitable for fighting Class A (solid combustibles), Class B (flammable liquids), and Class C (electrical) fires. Applications Novec fire suppression systems are ideal for protecting high-value assets and mission-critical areas, including: Data centers and server rooms Telecommunication facilities Control rooms Museums, archives, and libraries Medical and laboratory facilities Electrical panels and enclosures

A Novec fire suppression system uses 3M™ Novec™ 1230 fluid, a clean agent designed for use in sensitive environments like data centers, museums, and telecommunications centers. It is an environmentally friendly, waterless, and residue-free solution that suppresses fires quickly without harming people or damaging valuable electronics and documents. Novec 1230 Fire Suppression System, Novec 1230 Fire ... NOVEC 1230 Fire Safety System Novec 1230 Fire Suppression System Gas Fire System - Gas ... 3M™ Novec™ 1230 fire systems, 3M™ Novec™ 1230 fire suppression How it works Heat absorption: The primary extinguishing mechanism of Novec 1230 fluid is removing heat from the fire. Fire needs three elements to burn: heat, oxygen, and fuel. By rapidly absorbing heat, the system extinguishes the fire in seconds. Total flooding system: In a typical setup, the fluid is stored as a liquid in cylinders pressurized with nitrogen. When detectors sense a fire, the system automatically releases the Novec 1230 fluid into the protected space as a gas. Rapid vaporization: The fluid has a low heat of vaporization and evaporates more than 50 times faster than water. This allows it to rapidly fill the enclosed space and distribute evenly to suppress the fire. Localized suppression: Some systems use heat-sensitive tubing that ruptures at the point of the fire, releasing the agent directly onto the flames for instant suppression. Key features and benefits Environmentally safe: As a replacement for ozone-depleting Halon and some hydrofluorocarbons (HFCs), Novec 1230 fluid has a very low Global Warming Potential (GWP) of less than one and an atmospheric lifetime of only five days. People safe: It has a high safety margin for human occupancy, providing a safe environment for people in the area at the time of discharge. Equipment safe: The agent is electrically non-conductive and non-corrosive, making it safe for protecting sensitive electrical equipment, electronics, and valuable items. Leaves no residue: Since the fluid is waterless and evaporates completely, it leaves no residue that would require extensive cleanup, minimizing business downtime. Effective on multiple fire classes: Novec 1230 systems are suitable for fighting Class A (solid combustibles), Class B (flammable liquids), and Class C (electrical) fires. Applications Novec fire suppression systems are ideal for protecting high-value assets and mission-critical areas, including: Data centers and server rooms Telecommunication facilities Control rooms Museums, archives, and libraries Medical and laboratory facilities Electrical panels and enclosures

  • 2025-10-03T10:16:46

Have any question or need any business consultation?

Have any question or need any business consultation?

Contact Us
Chat with us