Home> Products> hazard area

{ "products": [ { "_id": "681b6163bd1f50f146548dca", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Gas Suppression", "description": "FM 200/Novec 1230 is a waterless fire suppression system that can be used as an alternative to Halon 1301. FM 200/Novec 1230 also provides an environmentally safe, non-toxic product that requires no clean-up, and can be used in rooms that have anything from computer servers to art and history collections.\n\nFM-200/Novec 1230 is another clean agent fire extinguishing medium used for the protection of data processing and telecommunication facilities. FM-200/Novec 1230 requires a concentration range of between 6.25 percent and 9.0 percent for effective fire extinguishment.\n\nFM-200/Novec 1230 leaves no residue or deposits upon discharge and can be removed from an area with simple ventilation.\n\nFM-200/Novec 1230 is stored in cylinders as a liquid. The cylinders are pressurized with nitrogen which acts as a propelling mechanism for the discharge of the agent. As the agent reaches the discharge nozzle it is vaporized and floods the hazard area as a gas. An FM-200/Novec 1230 system can provide an effective fire extinguishing medium with modular hardware that requires minimal space for installation and a most effective means of fire suppression.\n\nHalon , FM-200, ECARO-25, Novec 1230, Sapphire, Argonite, Inergen, Pro-Inert, CO2, Dry Chem, Foam, Firetrace", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "90 percent", "625 percent", "discharge nozzle", "hazard area", "agent reaches", "effective means", "modular hardware", "fm200novec 1230 system", "propelling mechanism", "concentration range", "data processing", "computer servers", "requires minimal space" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 21, "imageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/0fe4e77d02de431abf028316213e6a37.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:34:27.743Z", "updatedon": "2025-05-07T13:34:27.744Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR/products/gas-suppression/21", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Server Room Protection", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5eb7e558303897fc398b", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Sensors ", "description": "Smoke Detector: A smoke detector also called a smoke alarm is a device that detects smoke, typically as an indicator of fire and issues a signal to a fire alarm system.\n\nHeat Detector: A heat detector is a fire alarm device designed to respond when the convicted thermal energy of a fire increases the temperature of a heat sensitive element. The thermal mass and conductivity of the element regulate the rate flow of heat into the element. All heat detectors have this thermal lag. Heat detectors have two main classifications of operation, “rate-of-rise” and “fixed temperature.”\n\nMultisensor Detector : Multisensor Detector comprises of both optical smoke and thermistor temperature sensors which give both a combined signal as well as a separate heat signal for improved false alarm management.\n\nDuct Detector: The Conventional Duct Smoke Detector provides early detection of smoke in the air moving through heating and ventilation (HVAC) ducts in commercial and industrial premises. Its purpose is to prevent the re-circulation of smoke from an area on fire to areas unaffected by the fire.\n\nBeam Detector : An optical beam smoke detector is a device that uses a projected beam of light to detect smoke across large areas, typically as an indicator of fire. They are used to detect fires in buildings where standard point smoke detectors would either be uneconomical or restricted for use by the height of the building. Optical beam smoke detectors are often installed in warehouses as a cost effective means of protecting large open spaces.\n\nGas Leak Detector: Gas leak detection is the process of identifying potentially hazardous gas leaks. These sensors usually employ an audible alarm to alert people when a dangerous gas has been detected.\n\nFlame Detector : Flame detection is the technology for detecting flames, using a flame detector. Flame detectors are optical equipment for the detection of flame phenomena of a fire. There are two categories of flame detection:\n\nFlame detector for the detection of a fire in a fire alarm system\nFlame scanner for monitoring the condition of a flame in a burner", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "early detection", "fire increases", "flame phenomena", "optical equipment", "detecting flames", "dangerous gas", "alert people", "audible alarm", "detect fires", "detect smoke", "industrial premises", "air moving", "combined signal", "optical smoke", "operation rateofrise", "main classifications", "rate flow", "element regulate", "smoke alarm", "heat detectors", "projected beam", "areas unaffected", "thermal mass", "smoke detector", "heat detector", "fire beam detector", "sensors smoke detector", "separate heat signal", "heat sensitive element", "thermistor temperature sensors", "detects smoke typically", "large areas typically", "convicted thermal energy", "cost effective means", "ventilation hvac ducts" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 12, "imageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/c4d74b55ac184dbb8eecd2ae3871f1a1.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:23:03.791Z", "updatedon": "2025-05-07T13:23:03.792Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR//sensors-/12", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5de53a26099a76a380a4", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Fire Detection and Alarm", "description": "A fire alarm system is basically a network of initiating devices, and notification devices connected to a Fire Alarm Control Panel (FACP) which is used to alert people of an emergency in a building. Some modern fire alarm systems are remotely monitored by fire alarm monitoring companies who will decipher messages sent from the fire alarm system and decide whether to send the Fire Department, notify building owners / service companies of system troubles.\n\nWhat is an FACP\n\nA Fire Alarm Control Panel is the brains of the fire alarm system. All of the parts on a fire alarm system communicate with the FACP, which in turn decides what to do. Modern FACPs include keypads, LCD screens, and communication ports that make the system easier to work with.\n\nAn FACP is generally inside a locked red box located somewhere safe, such as an electrical room, office, or maintenance area. In some cases where there are no available rooms to install the FACP, the FACP might be located somewhere outside the building in a weather proof plastic enclosure.\n\nWhat is an Initiating Device\n\nAn initiating device is a sensor which detects things that are commonly a sign of fires and other hazards, or a switch that makes it possible for building occupants to set off the fire alarm manually when there’s an emergency none of the sensors can detect.\n\nCommon initiating device sensors include smoke detectors, heat detectors, and water flow detectors on fire sprinklers. Manual initiating devices pretty much consist of various styles of pull stations.\n\nWhat is a Notification Device\n\nA notification device, or notification appliance, is a device that tells everyone in the building the fire alarm is going off. Common notification appliances include horns / speakers (sounders), strobe lights, and various combinations of the three.\n\nUnfortunately some people are hearing impaired and other people are vision impaired. Some buildings have areas with a lot of ambient noise that makes it impossible to hear sounders. Some areas in buildings such as public restrooms amplify sound to harmful levels. Some areas such as hospital operating rooms have activities going on in them which could lead to disaster if a sudden loud annoying noise were to be made. Therefore we have notification appliances that can be seen and heard in a building.\n\nIn advanced fire alarm systems there may be what’s referred to as an EVAC system. An EVAC system is basically an intercom that will play a prerecorded evacuation plan over the loudspeakers when the fire alarm goes off, and make it possible for management to pick up a microphone and communicate with everyone in the building at once.\n\nYour fire-detection system can also:\n\nDischarge clean agent fire-suppression systems in computer rooms or clean rooms.\nActivate deluge fire systems in aircraft hangers or similarly dangerous areas.\nOpen a dry pipe sprinkler system for a pre-action suppression system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "building occupants", "alert people", "initiating device", "aircraft hangers", "computer rooms", "whats referred", "harmful levels", "hear sounders", "ambient noise", "vision impaired", "hearing impaired", "pull stations", "detects things", "maintenance area", "generally inside", "communication ports", "modern facps", "turn decides", "decipher messages", "remotely monitored", "notification device", "notification appliance", "firedetection system", "evac system", "system easier", "system troubles", "initiating devices", "fire detection", "notification appliances", "fire alarm", "fire alarm system", "common notification appliances", "notification devices connected", "hospital operating rooms", "fire alarm manually", "preaction suppression system", "prerecorded evacuation plan", "water flow detectors", "electrical room office", "keypads lcd screens" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 9, "imageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9fe317a603964235823331fc253697d2.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:19:33.065Z", "updatedon": "2025-05-07T13:19:33.066Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR/products/fire-detection-and-alarm/9", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Fire Detection and Alarm", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d9d6925cdc24b7681d9", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Foam water sprinkler", "description": "Designing a foam fire suppression system requires special expertise\n\nLow Expansion Foam\n\nLow Expansion foam offers a 5:1 expansion rate, making it the foam system of choice to protect large and hazardous facilities, including; petro-chemical tank farms, loading docks, processing areas and refineries and liquefied natural gas storage.\n\nHigh Expansion Foam\n\nWith an expansion rate of 500:1, High Expansion foam systems are more suitable to protect less common three-dimensional hazardous facilities including; warehouses, conveyors, aircraft hangars and tunnels. As such, High Expansion foam is measured by volume output rather than application rate, as is typical of low expansion foams.\n\nDischarge Devices\n\nWith both low and high expansion foam systems, once a facility has been evaluated either an ‘Aspirating’ or ‘Non-Aspirating’ discharge device’ will be recommended, based on the facilities requirements.\n\nAspirating discharge devices – produces a more viscous foam – great for reducing burn back and keeping the foam contained.\nNon-aspirating discharge devices – are best used where the foam is needed to spread over a large area. Talk to a Wormald specialist about your situation.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "wormald specialist", "recommended based", "application rate", "volume output", "hazardous facilities", "protect large", "foam system", "expansion rate", "high expansion foam", "viscous foam great", "foam water sprinklerdesigning", "large area talk", "reducing burn back", "nonaspirating discharge device" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 8, "imageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4d433bc9921a4a08b61c7c6c4b748a7f.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:18:21.329Z", "updatedon": "2025-05-07T13:18:21.329Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR//foam-water-sprinkler/8", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5d2a701ce9d7e115dcfc", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Water Spray systems", "description": "Water spray nozzles are designed to spray water directly onto the hazard surface via a series of nozzles with a carefully predetermined spray pattern. They are suitable for a variety of special hazards including transformer, turbines and combustible liquid hazards and systems can be individually tailored to your needs.\n\nHigh velocity systems – getting under the fire\n\nHigh velocity systems are often used to protect equipment that incorporate heavy or medium oils; equipment such as transformers, circuit breakers, diesel engines and fuel oil storage tanks, turbo alternator lube oil systems and oil fired boilers.\n\nThe high velocity nozzles are specifically designed to discharge a jet of water at high speed. The water jet forms a cone of coarse spray of uniform density which is discharged over a defined area. The coarse spray is able to penetrate the flame zone and reach the surface of the burning oil. The turbulence created by the high velocity spray forms an oil-in-water emulsion on the surface of the oil that will not burn. This “emulsification” is the principal way the fire is extinguished, along with a cooling and smothering effect.\n\nThe shape of the spray cone, the fire area contacted and the water flow is all controlled by the nozzle specifications – the orifice size and the shape of the internal swirl plate – along with the water pressure and the orientation of the nozzle.\n\nMedium velocity systems – cooling fire down\n\nMedium velocity sprayers discharge a water spray of finely divided droplets at medium velocity. They are ideal for protecting hazards involving light oils where emulsification from high velocity sprayers is not possible. The fine spray has a high heat absorption rate so medium velocity sprayers are an effective method of protecting adjacent plant and structures from heat during a fire by providing a continuous cooling spray over the exposed surfaces. Keeping nearby equipment cool minimises damage and reduces the risk of explosion.\n\nMedium velocity sprayers can be used in combination with other fire fighting systems – dry chemical and foam can be used effectively under the discharge. The fine spray also works to dilute and disperse flammable vapours. The sprayers use an external deflector to achieve the desired discharge angle and spray characteristics", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "hazard surface", "specifically designed", "spray cone", "external deflector", "effective method", "orifice size", "nozzle specifications", "smothering effect", "oilinwater emulsion", "turbulence created", "burning oil", "flame zone", "uniform density", "incorporate heavy", "individually tailored", "transformer turbines", "water pressure", "water flow", "spray characteristics", "fine spray", "coarse spray", "water spray", "defined area", "protect equipment", "special hazards", "high speed", "medium velocity", "water jet forms", "fire area contacted", "continuous cooling spray", "spray water directly", "high velocity nozzles", "high velocity systems", "desired discharge angle", "medium velocity sprayers", "high velocity sprayers", "oil fired boilers", "medium oils equipment", "combustible liquid hazards", "disperse flammable vapours", "protecting adjacent plant", "finely divided droplets", "internal swirl plate" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 7, "imageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/41c342e5fc2c4f0e958fe517ef02161b.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:16:26.609Z", "updatedon": "2025-05-07T13:16:26.609Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR//water-spray-systems/7", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5cf1bc744980d54e15c8", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Deluge System", "description": "A deluge system is similar to a pre-action system except the sprinkler heads are open and the pipe is not pressurized with air. Deluge systems are connected to a water supply through a deluge valve that is opened by the operation of a smoke or heat detection system. The detection system is installed in the same area as the sprinklers. When the detection system is activated water discharges through all of the sprinkler heads in the system. Deluge systems are used in places that are considered high hazard areas such as power plants, aircraft hangars and chemical storage or processing facilities. Deluge systems are needed where high velocity suppression is necessary to prevent fire spread.\n\nDeluge Fire Sprinkler Systems differ from conventional Fire Sprinkler Systems in the sense that all sprinkles or nozzles employed in the system are open and when water is released into the system it flows from all discharge devices. As such, this special type of system is generally found within industrial type hazards that require the application of water over a large hazard or area. The control of water is accomplished by the use of a Deluge Valve which is a device that prevents water from entering the system piping until required. A detection system which may incorporate the use of heat, smoke, or flame detectors is used to open the Deluge Valve when a fire or its products of combustion are detected. All system piping is filled with water which discharges from the open sprinklers and nozzles used in the system. In addition to the application of water some deluge systems will incorporate the use of a foam concentrate to mix with water and form a foam solution which can then provide a protective blanket of foam to help control the development of a fire.\nDeluge Fire Sprinkler systems protect extra hazard occupancies that require significant amounts of water to cool and control the growth or development of a fire. Typically they are employed on hazards that contain low flash point flammable liquids or hazards with large amounts of combustible liquids. These types of hazards may include, oil extraction processes, transformers, tank or vessel protection, distillation processes. Water or Foam Deluge systems are used in the protection of large Aircraft Hangers as one primary means of fire protection.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "open sprinklers", "nozzles employed", "fire protection", "prevents water", "water supply", "fire typically", "system piping", "preaction system", "primary means", "combustible liquids", "protective blanket", "foam solution", "foam concentrate", "flame detectors", "heat smoke", "generally found", "discharge devices", "chemical storage", "sprinkler heads", "detection system", "large hazard", "deluge valve", "special type", "large amounts", "deluge systems", "activated water discharges", "heat detection system", "industrial type hazards", "system deluge systems", "foam deluge systems", "require significant amounts", "air deluge systems", "large aircraft hangers", "high velocity suppression" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 6, "imageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/4f5cb93e84da4ea79642107f131c9fae.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:15:29.727Z", "updatedon": "2025-05-07T13:15:29.728Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR/products/deluge-system/6", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Sprinkler System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5f864d3fb9d238d49dba", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Security Systems", "description": "Security Systems: A security alarm is a system designed to detect intrusion – unauthorized entry – into a building or area. Security alarms are used in residential, commercial, industrial, and military properties for protection against burglary (theft) or property damage, as well as personal protection against intruders.\n\nSome alarm systems serve a single purpose of burglary protection; combination systems provide both fire and intrusion protection. Intrusion alarm systems may also be combined with closed-circuit television surveillance systems to automatically record the activities of intruders, and may interface to access control systems for electrically locked doors. Systems range from small, self-contained noisemakers, to complicated, multi-area systems with computer monitoring and control.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "personal protection", "computer monitoring", "automatically record", "single purpose", "property damage", "burglary theft", "military properties", "system designed", "security alarm", "access control systems", "alarm systems serve", "area security alarms", "security systemssecurity systems", "complicated multiarea systems", "small selfcontained noisemakers", "residential commercial industrial" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 16, "imageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/059fd5929c694d8e9a0d4678489a81f3.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:26:30.58Z", "updatedon": "2025-05-07T13:26:30.58Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR/products/security-systems/16", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Security Systems", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5f5b4162939e1cd4d0ac", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Emergency/Exit Signages", "description": "Safety is the number one reason to clearly have Exit emergency signs marked on doors, stairways, halls and elevators, for where exits are not immediately visible to the occupant. Exit emergency signs mark the way to safety, featuring internationally recognised symbols. They are an effective guidance tool, suitable for high traffic areas and to convey important messages, helping to reduce panic and confusion by providing a clear, easy-to-follow directional system.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "reduce panic", "immediately visible", "emergencyexit signagessafety", "high traffic areas", "doors stairways halls" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 15, "imageuri": "https://bizimages.withfloats.com/actual/3766731d11634958944bd9946d6e1572.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/3766731d11634958944bd9946d6e1572.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:25:47.862Z", "updatedon": "2025-05-07T13:25:47.863Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR//emergency-exit-signages/15", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Evacuation System", "tags": null, "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false }, { "_id": "681b5f295d31b5f2e0d46dbc", "fptag": "SAFENGINEERINGLINCSSYSTEMPVTLTABEA", "merchantname": null, "customwidgets": null, "externalsourceid": null, "name": "Public Address & Voice Alarm Systems", "description": "Public Address / Talk back System:\n\nA Public Address (PA) system is a collection of audio equipment that allows broadcasts over a designated area. Often found in schools and office buildings, PA systems can be used for general announcements or emergency information, providing a simple way to get information out quickly. PA systems can be basic or advanced, and people can customize them to fit a variety of needs.\n\nBasic PA systems are comprised of loudspeakers placed in convenient locations, an amplifier to increase the sound, and a mixer that adjusts audio levels. The user speaks into a microphone, and the sound is transmitted through connected cables, or a wireless system, out through the speakers. Some systems also include microphones or intercoms near the speaker locations, allowing the listener to reply to the central location. These responses are not broadcast to the entire system, however, but only to the main user area.", "price": 0.0, "discountamount": 0.0, "currencycode": "INR", "priority": 1000000, "isfreeshipmentavailable": false, "shipmentduration": 0, "_keywords": [ "entire system", "central location", "wireless system", "connected cables", "general announcements", "user speaks", "convenient locations", "designated area", "audio equipment", "basic pa systems", "main user area", "emergency information providing", "quickly pa systems", "speaker locations allowing", "adjusts audio levels" ], "isarchived": false, "isavailable": true, "applicationid": null, "productindex": 14, "imageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg", "tileimageuri": "https://bizimages.withfloats.com/actual/9bba1eb32e364b5087648614040aa450.jpg", "images": null, "totalqueries": 0, "gpid": null, "groupproductid": null, "createdon": "2025-05-07T13:24:57.042Z", "updatedon": "2025-05-07T13:24:57.043Z", "buyonlinelink": null, "producturl": "https://WWW.SAFELINCSINDIA.IN/HOSUR//public-address-voice-alarm-systems/14", "availableunits": -1.0, "iscodavailable": false, "isprepaidonlineavailable": true, "maxcodorders": 0, "maxprepaidonlineorders": 0, "uniquepaymenturl": null, "brandname": null, "category": "Evacuation System", "tags": [], "variants": false, "keyspecification": null, "otherspecifications": null, "pickupaddressreferenceid": null, "paymenttype": "AssuredPurchase", "producttype": "products", "hsncode": "", "gstslab": 0.001, "isnotforsale": false } ], "hasmoreitems": false, "isapirequest": false, "totalresults": 24, "query": null, "floatingpoint": null }